Clone LD32106 Report

Search the DGRC for LD32106

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:321
Well:6
Vector:pOT2
Associated Gene/TranscriptRpS9-RB
Protein status:LD32106.pep: gold
Preliminary Size:1050
Sequenced Size:915

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3395 2001-01-01 Release 2 assignment
CG3395 2001-10-10 Blastp of sequenced clone
CG3395 2003-01-01 Sim4 clustering to Release 3
RpS9 2008-04-29 Release 5.5 accounting
RpS9 2008-08-15 Release 5.9 accounting
RpS9 2008-12-18 5.12 accounting

Clone Sequence Records

LD32106.complete Sequence

915 bp (915 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061396

> LD32106.complete
CAAAACCTGCTCGGTTGAATTGTCGGAACCATGGTGAACGGCCGCATACC
CTCGGTCTTCTCGAAGACCTACGTGACTCCCCGTCGCCCCTATGAGAAGG
CGCGTCTGGACCAGGAGTTGAAGATCATCGGCGAGTATGGTCTGCGCAAC
AAGCGCGAAGTGTGGCGCGTCAAGTACGCCCTGGCTAAGATCCGTAAGGC
CGCTCGTGAGCTGCTGACCCTCGACGAGAAGGACGAGAAGCGTCTGTTCC
AGGGTAATGCCCTGCTGCGCCGTCTGGTCCGTATCGGTGTCCTGGACGAG
TCCCGCATGAAGCTCGATTACGTGCTGGGTCTGAAGATTGAGGACTTCTT
GGAGCGTCGTCTGCAGACGCAGGTGTTCAAGCTGGGACTTGCCAAGTCCA
TCCATCATGCTCGCGTCCTGATCCGTCAGCGTCACATTCGGTAAATATCG
CTTGGACAGGCGACAACATCGTCGCCAGGCTCTCTCAGATATAAACTCTG
TTCTGTTCAGTAAGACCACTTGGGAGTCGAACAGGCGCCAATGCTTGTAC
CGACTCTCAACGTCTGTAGATTGCGCATGTGACTCCGTTCACACCAATCG
AAAATGCAAAATGCCCGCCTAGCTGTCCGCAAGCAGGTGGTCAACATCCC
GTCGTTCGTCGTGCGCCTGGACTCCCAGAAGCACATCGACTTCTCCCTGA
AGTCGCCCTTCGGCGGCGGCCGTCCCGGTCGCGTCAAGAGGAAGAACCTG
AAGAAGAACCAGGGCGGTGGCGGTGGAGCTGCTGAAGAGGAGGAGGACTA
AGCAGTGGTAGCCAGCTGTAGCCAAGACAAATACATGGCGCAGACTTGAT
AAAAATCCGTTTGCTTTACACAAATAAATGTAAAAATACACGAAAAAAAA
AAAAAAAAAAAAAAA

LD32106.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:15:04
Subject Length Description Subject Range Query Range Score Percent Strand
RpS9-RB 928 RpS9-RB 37..928 1..892 4460 100 Plus
RpS9-RA 922 RpS9-RA 105..544 1..440 2200 100 Plus
RpS9-RD 967 RpS9-RD 169..601 8..440 2165 100 Plus
RpS9-RA 922 RpS9-RA 545..815 624..894 1355 100 Plus
RpS9-RD 967 RpS9-RD 602..872 624..894 1355 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:46:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 9502147..9502517 623..253 1855 100 Minus
chr3L 24539361 chr3L 9501755..9502023 892..624 1345 100 Minus
chr3L 24539361 chr3L 9502917..9503166 257..8 1250 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:26:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:46:53
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9510282..9510652 623..253 1855 100 Minus
3L 28110227 3L 9509888..9510158 894..624 1355 100 Minus
3L 28110227 3L 9511052..9511301 257..8 1250 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:38:43
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 9503382..9503752 623..253 1855 100 Minus
3L 28103327 3L 9502988..9503258 894..624 1355 100 Minus
3L 28103327 3L 9504152..9504401 257..8 1250 100 Minus
Blast to na_te.dros performed on 2019-03-16 11:46:53 has no hits.

LD32106.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:48:05 Download gff for LD32106.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 9502921..9503166 8..253 100   Minus
chr3L 9501755..9502023 624..892 100 <- Minus
chr3L 9502147..9502516 254..623 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:13:34 Download gff for LD32106.complete
Subject Subject Range Query Range Percent Splice Strand
RpS9-RB 1..414 31..444 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:56:18 Download gff for LD32106.complete
Subject Subject Range Query Range Percent Splice Strand
RpS9-RB 1..414 31..444 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:41:43 Download gff for LD32106.complete
Subject Subject Range Query Range Percent Splice Strand
RpS9-RB 1..414 31..444 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:25:28 Download gff for LD32106.complete
Subject Subject Range Query Range Percent Splice Strand
RpS9-RB 1..414 31..444 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:26:18 Download gff for LD32106.complete
Subject Subject Range Query Range Percent Splice Strand
RpS9-RB 1..414 31..444 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:42:16 Download gff for LD32106.complete
Subject Subject Range Query Range Percent Splice Strand
RpS9-RB 37..928 1..892 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:56:18 Download gff for LD32106.complete
Subject Subject Range Query Range Percent Splice Strand
RpS9-RB 37..928 1..892 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:41:43 Download gff for LD32106.complete
Subject Subject Range Query Range Percent Splice Strand
RpS9-RB 26..917 1..892 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:25:28 Download gff for LD32106.complete
Subject Subject Range Query Range Percent Splice Strand
RpS9-RB 37..928 1..892 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:26:18 Download gff for LD32106.complete
Subject Subject Range Query Range Percent Splice Strand
RpS9-RB 26..917 1..892 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:48:05 Download gff for LD32106.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9509890..9510158 624..892 100 <- Minus
3L 9510282..9510651 254..623 100 <- Minus
3L 9511056..9511301 8..253 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:48:05 Download gff for LD32106.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9509890..9510158 624..892 100 <- Minus
3L 9510282..9510651 254..623 100 <- Minus
3L 9511056..9511301 8..253 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:48:05 Download gff for LD32106.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9509890..9510158 624..892 100 <- Minus
3L 9510282..9510651 254..623 100 <- Minus
3L 9511056..9511301 8..253 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:41:43 Download gff for LD32106.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 9502990..9503258 624..892 100 <- Minus
arm_3L 9503382..9503751 254..623 100 <- Minus
arm_3L 9504156..9504401 8..253 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:02:37 Download gff for LD32106.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9504156..9504401 8..253 100   Minus
3L 9502990..9503258 624..892 100 <- Minus
3L 9503382..9503751 254..623 100 <- Minus

LD32106.pep Sequence

Translation from 30 to 443

> LD32106.pep
MVNGRIPSVFSKTYVTPRRPYEKARLDQELKIIGEYGLRNKREVWRVKYA
LAKIRKAARELLTLDEKDEKRLFQGNALLRRLVRIGVLDESRMKLDYVLG
LKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIR*

LD32106.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 10:02:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24655-PA 195 GF24655-PA 1..137 1..137 696 100 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 10:02:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14025-PA 195 GG14025-PA 1..137 1..137 696 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 10:02:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15146-PA 195 GH15146-PA 1..137 1..137 697 100 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:34
Subject Length Description Subject Range Query Range Score Percent Strand
RpS9-PB 137 CG3395-PB 1..137 1..137 685 100 Plus
RpS9-PE 195 CG3395-PE 1..137 1..137 685 100 Plus
RpS9-PD 195 CG3395-PD 1..137 1..137 685 100 Plus
RpS9-PA 195 CG3395-PA 1..137 1..137 685 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 10:02:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12083-PA 195 GI12083-PA 1..137 1..137 692 99.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 10:02:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20135-PA 195 GL20135-PA 1..137 1..137 695 100 Plus
Dper\GL21280-PA 195 GL21280-PA 1..137 1..137 695 100 Plus
Dper\GL17960-PA 195 GL17960-PA 1..137 1..137 695 100 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:02:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28351-PA 195 GA28351-PA 1..137 1..137 695 100 Plus
Dpse\GA29203-PA 84 GA29203-PA 2..76 14..114 275 63.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 10:02:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24860-PA 195 GM24860-PA 1..137 1..137 696 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 10:02:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12912-PA 195 GD12912-PA 1..137 1..137 696 100 Plus
Dsim\GD17704-PA 138 GD17704-PA 54..90 43..82 157 85 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 10:02:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13353-PA 195 GJ13353-PA 1..137 1..137 696 100 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 10:02:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17575-PA 195 GK17575-PA 1..137 1..137 696 100 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 10:02:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\RpS9-PA 195 GE21228-PA 1..137 1..137 696 100 Plus

LD32106.hyp Sequence

Translation from 30 to 443

> LD32106.hyp
MVNGRIPSVFSKTYVTPRRPYEKARLDQELKIIGEYGLRNKREVWRVKYA
LAKIRKAARELLTLDEKDEKRLFQGNALLRRLVRIGVLDESRMKLDYVLG
LKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIR*

LD32106.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:28:11
Subject Length Description Subject Range Query Range Score Percent Strand
RpS9-PB 137 CG3395-PB 1..137 1..137 685 100 Plus
RpS9-PE 195 CG3395-PE 1..137 1..137 685 100 Plus
RpS9-PD 195 CG3395-PD 1..137 1..137 685 100 Plus
RpS9-PA 195 CG3395-PA 1..137 1..137 685 100 Plus