BDGP Sequence Production Resources |
Search the DGRC for LD32148
Library: | LD |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Ling Hong |
Date Registered: | 1997-12-04 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 321 |
Well: | 48 |
Vector: | pOT2 |
Associated Gene/Transcript | RpS10a-RA |
Protein status: | LD32148.pep: validated not full length |
Preliminary Size: | 529 |
Sequenced Size: | 549 |
Gene | Date | Evidence |
---|---|---|
CG12275 | 2001-01-01 | Release 2 assignment |
CG12275 | 2002-12-11 | Blastp of sequenced clone |
CG12275 | 2003-01-01 | Sim4 clustering to Release 3 |
RpS10a | 2008-04-29 | Release 5.5 accounting |
RpS10a | 2008-08-15 | Release 5.9 accounting |
RpS10a | 2008-12-18 | 5.12 accounting |
549 bp (549 high quality bases) assembled on 2002-12-11
GenBank Submission: AF145693
> LD32148.complete TTCATTCCAAAAGCCAATCGTGTCGCCATCTACGAGTACCTCTTCAAGGA GGGTGTGCTCGTGGCCAAGAAGGACTCGCCCATCCAGAAGCACTCCGAAC TGGATAAGATTCCCAATCTGCAAGTCATCAAGGTGATGCAGTCGCTGAAC TCACGTGGCTGGGTCAAGGAGCAGTTTGCCTGGCGCCACTTCTACTGGTT GCTGACCAACGAGGGCATCGAGGAACTGCGCCGCTATCTGCACTTGCCCC CGGAGATTGTGCCCTCCACTTTGACGCAAACTACTCGATCGAACGCAGTG CGTCCGCGCGGAGGACCAGGAGGACCCGGAGGAGGATTCGGAGGCGCCTC CAAAACCGATGACGACAGATCGAACTACAGACGCGGTCCAGGCGCATATG GAATGGACAAGAAAGGCGATGTGGGTGCCGGAACCGGACGGGTCGAATAT CGTGGCGGTTTCGGTCGTGCTTCTCGCTACGACAATTAAAATAATGGAAA AATATAGTTGTTGCATAAAAACGATAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpS10a-RA | 532 | RpS10a-RA | 4..529 | 1..526 | 2630 | 100 | Plus |
RpS10b-RC | 772 | RpS10b-RC | 214..396 | 84..266 | 420 | 81.9 | Plus |
RpS10b.a | 1127 | RpS10b.a | 280..462 | 84..266 | 420 | 81.9 | Plus |
RpS10b-RC | 772 | RpS10b-RC | 137..204 | 7..74 | 265 | 92.6 | Plus |
RpS10b.a | 1127 | RpS10b.a | 203..270 | 7..74 | 265 | 92.6 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 23475754..23476278 | 1..525 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS10a-RA | 4..492 | 1..489 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS10a-RA | 4..492 | 1..489 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS10a-RA | 4..492 | 1..489 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS10a-RA | 4..492 | 1..489 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS10a-RA | 4..492 | 1..489 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS10a-RA | 4..528 | 1..525 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS10a-RA | 4..528 | 1..525 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS10a-RA | 80..604 | 1..525 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS10a-RA | 4..528 | 1..525 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpS10a-RA | 80..604 | 1..525 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 27652839..27653363 | 1..525 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 27652839..27653363 | 1..525 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 27652839..27653363 | 1..525 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 23478561..23479085 | 1..525 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 27393670..27394194 | 1..525 | 100 | Plus |
Translation from 0 to 488
> LD32148.pep FIPKANRVAIYEYLFKEGVLVAKKDSPIQKHSELDKIPNLQVIKVMQSLN SRGWVKEQFAWRHFYWLLTNEGIEELRRYLHLPPEIVPSTLTQTTRSNAV RPRGGPGGPGGGFGGASKTDDDRSNYRRGPGAYGMDKKGDVGAGTGRVEY RGGFGRASRYDN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF20407-PA | 160 | GF20407-PA | 2..159 | 1..159 | 594 | 73.6 | Plus |
Dana\GF16988-PA | 187 | GF16988-PA | 2..146 | 1..146 | 530 | 69.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG11564-PA | 164 | GG11564-PA | 2..162 | 1..160 | 603 | 77.6 | Plus |
Dere\GG19233-PA | 160 | GG19233-PA | 2..159 | 1..159 | 583 | 72.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH24937-PA | 160 | GH24937-PA | 2..159 | 1..159 | 585 | 72.3 | Plus |
Dgri\GH11289-PA | 164 | GH11289-PA | 2..162 | 1..159 | 348 | 47.6 | Plus |
Dgri\GH10453-PA | 164 | GH10453-PA | 2..164 | 1..161 | 345 | 47.1 | Plus |
Dgri\GH17537-PA | 278 | GH17537-PA | 2..149 | 1..146 | 305 | 47.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpS10a-PA | 163 | CG12275-PA | 2..163 | 1..162 | 870 | 100 | Plus |
RpS10b-PE | 160 | CG14206-PE | 2..159 | 1..159 | 606 | 74.2 | Plus |
RpS10b-PD | 160 | CG14206-PD | 2..159 | 1..159 | 606 | 74.2 | Plus |
RpS10b-PC | 160 | CG14206-PC | 2..159 | 1..159 | 606 | 74.2 | Plus |
RpS10b-PB | 160 | CG14206-PB | 2..159 | 1..159 | 606 | 74.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI11113-PA | 160 | GI11113-PA | 2..159 | 1..159 | 590 | 73 | Plus |
Dmoj\GI17705-PA | 161 | GI17705-PA | 2..158 | 1..156 | 361 | 49.4 | Plus |
Dmoj\GI24509-PA | 161 | GI24509-PA | 2..151 | 1..149 | 328 | 47.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL21283-PA | 136 | GL21283-PA | 6..135 | 29..159 | 477 | 71.8 | Plus |
Dper\GL27054-PA | 104 | GL27054-PA | 2..100 | 1..99 | 406 | 76.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12822-PA | 160 | GA12822-PA | 2..159 | 1..159 | 595 | 73.6 | Plus |
Dpse\GA24698-PA | 65 | GA24698-PA | 4..42 | 52..90 | 146 | 74.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM16347-PA | 164 | GM16347-PA | 2..164 | 1..162 | 693 | 86.5 | Plus |
Dsec\GM22969-PA | 160 | GM22969-PA | 2..159 | 1..159 | 593 | 73.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD17450-PA | 160 | GD17450-PA | 2..159 | 1..159 | 593 | 73.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ15969-PA | 160 | GJ15969-PA | 2..159 | 1..159 | 591 | 73 | Plus |
Dvir\GJ11441-PA | 159 | GJ11441-PA | 2..156 | 1..156 | 372 | 51.3 | Plus |
Dvir\GJ16313-PA | 159 | GJ16313-PA | 2..156 | 1..156 | 372 | 51.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK25475-PA | 160 | GK25475-PA | 2..159 | 1..159 | 602 | 74.2 | Plus |
Translation from 0 to 488
> LD32148.hyp FIPKANRVAIYEYLFKEGVLVAKKDSPIQKHSELDKIPNLQVIKVMQSLN SRGWVKEQFAWRHFYWLLTNEGIEELRRYLHLPPEIVPSTLTQTTRSNAV RPRGGPGGPGGGFGGASKTDDDRSNYRRGPGAYGMDKKGDVGAGTGRVEY RGGFGRASRYDN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpS10a-PA | 163 | CG12275-PA | 2..163 | 1..162 | 870 | 100 | Plus |
RpS10b-PD | 160 | CG14206-PD | 2..159 | 1..159 | 606 | 74.2 | Plus |
RpS10b-PC | 160 | CG14206-PC | 2..159 | 1..159 | 606 | 74.2 | Plus |
RpS10b-PB | 160 | CG14206-PB | 2..159 | 1..159 | 606 | 74.2 | Plus |
RpS10b-PE | 160 | CG14206-PE | 2..159 | 1..159 | 606 | 74.2 | Plus |