Clone LD32148 Report

Search the DGRC for LD32148

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:321
Well:48
Vector:pOT2
Associated Gene/TranscriptRpS10a-RA
Protein status:LD32148.pep: validated not full length
Preliminary Size:529
Sequenced Size:549

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12275 2001-01-01 Release 2 assignment
CG12275 2002-12-11 Blastp of sequenced clone
CG12275 2003-01-01 Sim4 clustering to Release 3
RpS10a 2008-04-29 Release 5.5 accounting
RpS10a 2008-08-15 Release 5.9 accounting
RpS10a 2008-12-18 5.12 accounting

Clone Sequence Records

LD32148.complete Sequence

549 bp (549 high quality bases) assembled on 2002-12-11

GenBank Submission: AF145693

> LD32148.complete
TTCATTCCAAAAGCCAATCGTGTCGCCATCTACGAGTACCTCTTCAAGGA
GGGTGTGCTCGTGGCCAAGAAGGACTCGCCCATCCAGAAGCACTCCGAAC
TGGATAAGATTCCCAATCTGCAAGTCATCAAGGTGATGCAGTCGCTGAAC
TCACGTGGCTGGGTCAAGGAGCAGTTTGCCTGGCGCCACTTCTACTGGTT
GCTGACCAACGAGGGCATCGAGGAACTGCGCCGCTATCTGCACTTGCCCC
CGGAGATTGTGCCCTCCACTTTGACGCAAACTACTCGATCGAACGCAGTG
CGTCCGCGCGGAGGACCAGGAGGACCCGGAGGAGGATTCGGAGGCGCCTC
CAAAACCGATGACGACAGATCGAACTACAGACGCGGTCCAGGCGCATATG
GAATGGACAAGAAAGGCGATGTGGGTGCCGGAACCGGACGGGTCGAATAT
CGTGGCGGTTTCGGTCGTGCTTCTCGCTACGACAATTAAAATAATGGAAA
AATATAGTTGTTGCATAAAAACGATAAAAAAAAAAAAAAAAAAAAAAAA

LD32148.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:52:56
Subject Length Description Subject Range Query Range Score Percent Strand
RpS10a-RA 532 RpS10a-RA 4..529 1..526 2630 100 Plus
RpS10b-RC 772 RpS10b-RC 214..396 84..266 420 81.9 Plus
RpS10b.a 1127 RpS10b.a 280..462 84..266 420 81.9 Plus
RpS10b-RC 772 RpS10b-RC 137..204 7..74 265 92.6 Plus
RpS10b.a 1127 RpS10b.a 203..270 7..74 265 92.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:34:06
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 23475754..23476278 1..525 2580 99.4 Plus
chrX 22417052 chrX 19487255..19487514 7..266 625 82.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:26:07 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:34:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 27652839..27653364 1..526 2630 100 Plus
X 23542271 X 19598443..19598702 7..266 625 82.7 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:12:21
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 27393670..27394195 1..526 2630 100 Plus
X 23527363 X 19606618..19606800 84..266 420 81.9 Plus
X 23527363 X 19606541..19606608 7..74 265 92.6 Plus
Blast to na_te.dros performed on 2019-03-16 20:34:04 has no hits.

LD32148.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:35:03 Download gff for LD32148.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 23475754..23476278 1..525 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:13:41 Download gff for LD32148.complete
Subject Subject Range Query Range Percent Splice Strand
RpS10a-RA 4..492 1..489 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:49:35 Download gff for LD32148.complete
Subject Subject Range Query Range Percent Splice Strand
RpS10a-RA 4..492 1..489 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:24:06 Download gff for LD32148.complete
Subject Subject Range Query Range Percent Splice Strand
RpS10a-RA 4..492 1..489 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:31:39 Download gff for LD32148.complete
Subject Subject Range Query Range Percent Splice Strand
RpS10a-RA 4..492 1..489 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:07:04 Download gff for LD32148.complete
Subject Subject Range Query Range Percent Splice Strand
RpS10a-RA 4..492 1..489 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:00:05 Download gff for LD32148.complete
Subject Subject Range Query Range Percent Splice Strand
RpS10a-RA 4..528 1..525 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:49:35 Download gff for LD32148.complete
Subject Subject Range Query Range Percent Splice Strand
RpS10a-RA 4..528 1..525 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:24:06 Download gff for LD32148.complete
Subject Subject Range Query Range Percent Splice Strand
RpS10a-RA 80..604 1..525 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:31:39 Download gff for LD32148.complete
Subject Subject Range Query Range Percent Splice Strand
RpS10a-RA 4..528 1..525 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:07:04 Download gff for LD32148.complete
Subject Subject Range Query Range Percent Splice Strand
RpS10a-RA 80..604 1..525 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:35:03 Download gff for LD32148.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27652839..27653363 1..525 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:35:03 Download gff for LD32148.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27652839..27653363 1..525 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:35:03 Download gff for LD32148.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27652839..27653363 1..525 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:24:06 Download gff for LD32148.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 23478561..23479085 1..525 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:10:55 Download gff for LD32148.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27393670..27394194 1..525 100   Plus

LD32148.pep Sequence

Translation from 0 to 488

> LD32148.pep
FIPKANRVAIYEYLFKEGVLVAKKDSPIQKHSELDKIPNLQVIKVMQSLN
SRGWVKEQFAWRHFYWLLTNEGIEELRRYLHLPPEIVPSTLTQTTRSNAV
RPRGGPGGPGGGFGGASKTDDDRSNYRRGPGAYGMDKKGDVGAGTGRVEY
RGGFGRASRYDN*

LD32148.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:53:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20407-PA 160 GF20407-PA 2..159 1..159 594 73.6 Plus
Dana\GF16988-PA 187 GF16988-PA 2..146 1..146 530 69.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:53:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11564-PA 164 GG11564-PA 2..162 1..160 603 77.6 Plus
Dere\GG19233-PA 160 GG19233-PA 2..159 1..159 583 72.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:53:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24937-PA 160 GH24937-PA 2..159 1..159 585 72.3 Plus
Dgri\GH11289-PA 164 GH11289-PA 2..162 1..159 348 47.6 Plus
Dgri\GH10453-PA 164 GH10453-PA 2..164 1..161 345 47.1 Plus
Dgri\GH17537-PA 278 GH17537-PA 2..149 1..146 305 47.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:46:23
Subject Length Description Subject Range Query Range Score Percent Strand
RpS10a-PA 163 CG12275-PA 2..163 1..162 870 100 Plus
RpS10b-PE 160 CG14206-PE 2..159 1..159 606 74.2 Plus
RpS10b-PD 160 CG14206-PD 2..159 1..159 606 74.2 Plus
RpS10b-PC 160 CG14206-PC 2..159 1..159 606 74.2 Plus
RpS10b-PB 160 CG14206-PB 2..159 1..159 606 74.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:53:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11113-PA 160 GI11113-PA 2..159 1..159 590 73 Plus
Dmoj\GI17705-PA 161 GI17705-PA 2..158 1..156 361 49.4 Plus
Dmoj\GI24509-PA 161 GI24509-PA 2..151 1..149 328 47.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:53:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21283-PA 136 GL21283-PA 6..135 29..159 477 71.8 Plus
Dper\GL27054-PA 104 GL27054-PA 2..100 1..99 406 76.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:53:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12822-PA 160 GA12822-PA 2..159 1..159 595 73.6 Plus
Dpse\GA24698-PA 65 GA24698-PA 4..42 52..90 146 74.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:53:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16347-PA 164 GM16347-PA 2..164 1..162 693 86.5 Plus
Dsec\GM22969-PA 160 GM22969-PA 2..159 1..159 593 73.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:53:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17450-PA 160 GD17450-PA 2..159 1..159 593 73.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:53:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15969-PA 160 GJ15969-PA 2..159 1..159 591 73 Plus
Dvir\GJ11441-PA 159 GJ11441-PA 2..156 1..156 372 51.3 Plus
Dvir\GJ16313-PA 159 GJ16313-PA 2..156 1..156 372 51.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:53:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25475-PA 160 GK25475-PA 2..159 1..159 602 74.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:53:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23749-PA 164 GE23749-PA 2..162 1..160 625 80.1 Plus
Dyak\GE15852-PA 160 GE15852-PA 2..159 1..159 589 73 Plus

LD32148.hyp Sequence

Translation from 0 to 488

> LD32148.hyp
FIPKANRVAIYEYLFKEGVLVAKKDSPIQKHSELDKIPNLQVIKVMQSLN
SRGWVKEQFAWRHFYWLLTNEGIEELRRYLHLPPEIVPSTLTQTTRSNAV
RPRGGPGGPGGGFGGASKTDDDRSNYRRGPGAYGMDKKGDVGAGTGRVEY
RGGFGRASRYDN*

LD32148.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:58:44
Subject Length Description Subject Range Query Range Score Percent Strand
RpS10a-PA 163 CG12275-PA 2..163 1..162 870 100 Plus
RpS10b-PD 160 CG14206-PD 2..159 1..159 606 74.2 Plus
RpS10b-PC 160 CG14206-PC 2..159 1..159 606 74.2 Plus
RpS10b-PB 160 CG14206-PB 2..159 1..159 606 74.2 Plus
RpS10b-PE 160 CG14206-PE 2..159 1..159 606 74.2 Plus