Clone LD32220 Report

Search the DGRC for LD32220

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:322
Well:20
Vector:pOT2
Associated Gene/TranscriptCG11263-RA
Protein status:LD32220.pep: gold
Preliminary Size:862
Sequenced Size:1027

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11263 2002-01-01 Sim4 clustering to Release 2
CG11263 2002-05-18 Blastp of sequenced clone
CG11263 2003-01-01 Sim4 clustering to Release 3
CG11263 2008-04-29 Release 5.5 accounting
CG11263 2008-08-15 Release 5.9 accounting
CG11263 2008-12-18 5.12 accounting

Clone Sequence Records

LD32220.complete Sequence

1027 bp (1027 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118948

> LD32220.complete
CTTTTCAAAGCTTTTATTATCCGAAAAGCATAAATTACAATGAACAAGAG
CGATGGAAACGAGAGCTTTGCTCTGGACAGTCTCCCGGAAAACATTCGTT
ACCCTTTCGGAAAACGAGAACTGGAAATCCTGGAGAAGCAACTAGATCGA
ATTGTTTTGATATACCAGGTGGATACCACATACCACAGTGCACTAAAGGA
CATAAAGGATCAGAAGATCATATCGCTGCTGGTGGAGCCCAGTTTTTACG
GACGACATCACCCCACGTCTATTTTGGTGGTAGCCACGTGCAATGGAACG
TACATTTTCGACATCAAGGCCCTTGGCTTGATATTTCTGGAACTGGCCAA
GATTCTGGAGGCGGATCAGCCGCGCAAGGTAATCCACTACAGCCACCGGA
TCGCCGATCATCTGTTGCATAGGCAACGCATCTCGTTGGGAGGAATATTT
GATACCTTTGTGGCTGTATGCCTGAGCAGCAACACAAGAATTCCGTACAC
CTTGCCAGAGGCTATATCTCTCGTCTTCGGACTACCCATGGAGAAGGTGA
CTGGAGGCTGTGAGTCGCAGCGTAACTTCACTGCTCGTCCACTGACCCAC
AGTCAAATGAGATACTTGGCCAAGTTGGTCCAGCTTCAACACATAATGCA
CGATCATTTGAATTATAGTCACATCTTTTGCGCCGAGGTTTATCGCATAT
CCTTAGAGTTCAGCCACAGCTACTACGGCTTACGGTCCTGCGACGTCGCC
ATAAACATGGCACCTGCCAGTAGCTTCGGGTTCCAACTCTTAGATTCATT
CTGCAAAAAGGCCGACAAGGAACTCGAGCAGATCTAGGAGAGCACCAAAT
GGGTCGCAAGGTAAGGGATTAGTTTGGCAGGAATGTAATGTAATAGCTTC
TGCTGATATGTGTCTCATATATGCATATATGAGGTCAAGCATGATAGGTC
AAGGGACTTGCATGATATGCTCTCTTATTAAATGAAAATTTTTTTTCTTA
AAAGTTCTCAAAAAAAAAAAAAAAAAA

LD32220.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:03:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG11263-RB 1010 CG11263-RB 2..1010 1..1009 5045 100 Plus
CG11263-RA 1058 CG11263-RA 76..1058 27..1009 4915 100 Plus
nc_12347.a 120 nc_12347.a 26..120 46..140 475 100 Plus
CG11263-RA 1058 CG11263-RA 2..29 1..28 140 100 Plus
nc_12347.a 120 nc_12347.a 1..28 1..28 140 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:02:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 12997185..12998161 27..1009 4680 98.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:26:11 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:02:20
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13006899..13007886 27..1014 4940 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:34:41
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 12999999..13000986 27..1014 4940 100 Plus
3L 28103327 3L 12999925..12999952 1..28 140 100 Plus
Blast to na_te.dros performed on 2019-03-15 16:02:20 has no hits.

LD32220.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:03:10 Download gff for LD32220.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 12997111..12997138 1..28 100 -> Plus
chr3L 12997187..12998161 29..1009 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:13:44 Download gff for LD32220.complete
Subject Subject Range Query Range Percent Splice Strand
CG11263-RA 1..798 40..837 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:44:24 Download gff for LD32220.complete
Subject Subject Range Query Range Percent Splice Strand
CG11263-RB 1..798 40..837 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:50:11 Download gff for LD32220.complete
Subject Subject Range Query Range Percent Splice Strand
CG11263-RA 1..798 40..837 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:36:35 Download gff for LD32220.complete
Subject Subject Range Query Range Percent Splice Strand
CG11263-RA 1..798 40..837 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:24:24 Download gff for LD32220.complete
Subject Subject Range Query Range Percent Splice Strand
CG11263-RA 1..798 40..837 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:19:22 Download gff for LD32220.complete
Subject Subject Range Query Range Percent Splice Strand
CG11263-RA 2..29 1..28 100 -> Plus
CG11263-RA 78..1058 29..1009 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:44:24 Download gff for LD32220.complete
Subject Subject Range Query Range Percent Splice Strand
CG11263-RB 2..1010 1..1009 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:50:11 Download gff for LD32220.complete
Subject Subject Range Query Range Percent Splice Strand
CG11263-RB 9..1017 1..1009 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:36:36 Download gff for LD32220.complete
Subject Subject Range Query Range Percent Splice Strand
CG11263-RA 2..29 1..28 100 -> Plus
CG11263-RA 78..1058 29..1009 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:24:24 Download gff for LD32220.complete
Subject Subject Range Query Range Percent Splice Strand
CG11263-RB 9..1017 1..1009 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:03:10 Download gff for LD32220.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13006825..13006852 1..28 100 -> Plus
3L 13006901..13007881 29..1009 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:03:10 Download gff for LD32220.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13006825..13006852 1..28 100 -> Plus
3L 13006901..13007881 29..1009 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:03:10 Download gff for LD32220.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13006825..13006852 1..28 100 -> Plus
3L 13006901..13007881 29..1009 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:50:11 Download gff for LD32220.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 12999925..12999952 1..28 100 -> Plus
arm_3L 13000001..13000981 29..1009 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:08:58 Download gff for LD32220.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13000001..13000981 29..1009 100   Plus
3L 12999925..12999952 1..28 100 -> Plus

LD32220.pep Sequence

Translation from 39 to 836

> LD32220.pep
MNKSDGNESFALDSLPENIRYPFGKRELEILEKQLDRIVLIYQVDTTYHS
ALKDIKDQKIISLLVEPSFYGRHHPTSILVVATCNGTYIFDIKALGLIFL
ELAKILEADQPRKVIHYSHRIADHLLHRQRISLGGIFDTFVAVCLSSNTR
IPYTLPEAISLVFGLPMEKVTGGCESQRNFTARPLTHSQMRYLAKLVQLQ
HIMHDHLNYSHIFCAEVYRISLEFSHSYYGLRSCDVAINMAPASSFGFQL
LDSFCKKADKELEQI*

LD32220.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:24:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24627-PA 293 GF24627-PA 1..272 1..262 672 53.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:24:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15614-PA 235 GG15614-PA 24..217 76..264 760 74.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:24:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17078-PA 276 GH17078-PA 8..267 5..253 553 47.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:16:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG11263-PB 265 CG11263-PB 1..265 1..265 1374 100 Plus
CG11263-PA 265 CG11263-PA 1..265 1..265 1374 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:24:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11678-PA 279 GI11678-PA 39..271 27..254 587 50.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:24:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18050-PA 284 GL18050-PA 23..269 17..258 623 50 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:24:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22370-PA 284 GA22370-PA 23..269 17..258 631 50.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:24:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25386-PA 267 GM25386-PA 1..267 1..265 1275 91.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:24:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14419-PA 267 GD14419-PA 1..267 1..265 1270 91 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:24:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11350-PA 282 GJ11350-PA 16..276 4..256 620 49.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:24:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24824-PA 352 GK24824-PA 1..167 1..163 421 50.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:24:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21941-PA 274 GE21941-PA 1..271 1..264 1025 72.7 Plus

LD32220.hyp Sequence

Translation from 39 to 836

> LD32220.hyp
MNKSDGNESFALDSLPENIRYPFGKRELEILEKQLDRIVLIYQVDTTYHS
ALKDIKDQKIISLLVEPSFYGRHHPTSILVVATCNGTYIFDIKALGLIFL
ELAKILEADQPRKVIHYSHRIADHLLHRQRISLGGIFDTFVAVCLSSNTR
IPYTLPEAISLVFGLPMEKVTGGCESQRNFTARPLTHSQMRYLAKLVQLQ
HIMHDHLNYSHIFCAEVYRISLEFSHSYYGLRSCDVAINMAPASSFGFQL
LDSFCKKADKELEQI*

LD32220.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:36:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG11263-PB 265 CG11263-PB 1..265 1..265 1374 100 Plus
CG11263-PA 265 CG11263-PA 1..265 1..265 1374 100 Plus