Clone LD32260 Report

Search the DGRC for LD32260

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:322
Well:60
Vector:pOT2
Associated Gene/TranscriptCG42375-RA
Protein status:LD32260.pep: gold LD32260.pep2: gold
Preliminary Size:1320
Sequenced Size:1113

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9288 2001-01-01 Release 2 assignment
CG9288 2001-11-29 Blastp of sequenced clone
CG9288 2003-01-01 Sim4 clustering to Release 3
CG9288 2008-04-29 Release 5.5 accounting
CG9288 2008-08-15 Release 5.9 accounting
CG42375 2008-12-18 5.12 accounting
CG9288 2008-12-18 5.12 accounting

Clone Sequence Records

LD32260.complete Sequence

1113 bp (1113 high quality bases) assembled on 2001-11-29

GenBank Submission: AY069582.1

> LD32260.complete
TGACAACACACGCGAATCAGGAAAGTGGAAAGGCAATAAACCCGGCCGGA
ATCAGGAGAAAATGCATACGGATCTTTCCTCACATCTGCACACGCCCGCT
TGCAACAAGTTGATCGAGGAACTCCAGGCCTGCCACGAAAATAACGCCTT
CGCAAAATTTGTGGGCGTGTGCAACTCCATTGACGACAAGGTGGTCAAGT
GCCTAAAAGGCGAGAGAATCGCCCGATCCGCCGCTAATCGCGCCAAAGCC
CGTGAACGTCAGGCGAAGTACAAGGAAAAGTTGCTCCAGCAGGAAAGTAA
CTAAAGGAAAGAAATCAACCAGGATGTCAGTACAAGCAGATGATCCACTG
GAGCCATTCTACTTCGAGCACGAGGAGCAGGAGATCTGCGGGAAGCTCGT
AGCTCCCATTACAGATAGCTTCCAGGAGGATTACCCCAGTGTTGTAGATC
GTTTTTTCACCAGATATTACTACTTCAAGGGAGATGTTCCCTACCAAGTG
CTCTACCACTCCAATCGCATTTGTCTGATTTGCCTGGCTCCCGAGCACCC
TGCTCTAGCTCAAGGCATCTCATCGGTCAACTTTGATATAGGGAACGTAG
ATCGCAGCCAGAATGTGGTCAAGGGAAAGGGTAAAAAGGGCGGAATGATC
CTACAGGCGGAGTCCACCTTGGCACTGCTCACCACAGCAAATGGAGGGAC
TTACAAGGTGCCCAGCTGCATTCGGGGCAAGCTGGTAGAGGTGAACACCG
CCATTGTGGAGGAGCCAAAGCTTCTGGAGCAACTCCCCGAGGGAGCCGGC
TACTTCGCCATTCTTCTGCCCAAAATCGAAAACTGCGATGCAATCAAGGC
GAGTCTTTTAACCCAGGAGCAGTATGAGGAGCGCCTAAAATCGAAAAACG
AAGGTCTACCTCAAATTGAGTCCACCGGGGACCACGCTCAAAACAAAAAT
AAGGAGATTCAGGCGTGATTTTGACCCTTGTTTTGTTGTGCTTCTTCTAT
AAGGCCTTTGTATTTTAAATTAATGATTCATACATATATTATATTGCTCA
AAGTCAATGAGGACTTAAATAATAATAATTTTGACAGTAAACCACAAAAA
AAAAAAAAAAAAA

LD32260.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:55:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG42375-RA 1160 CG42375-RA 66..1160 1..1095 5475 100 Plus
CG9288-RA 1160 CG9288-RA 66..1160 1..1095 5475 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:11:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 9604731..9605686 143..1095 4490 98.2 Plus
chr3R 27901430 chr3R 9604532..9604673 1..142 710 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:26:16 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:11:53
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13779843..13780798 143..1098 4780 100 Plus
3R 32079331 3R 13779646..13779787 1..142 710 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:21:14
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 13520674..13521629 143..1098 4780 100 Plus
3R 31820162 3R 13520477..13520618 1..142 710 100 Plus
Blast to na_te.dros performed on 2019-03-16 01:11:54 has no hits.

LD32260.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:12:59 Download gff for LD32260.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 9604532..9604673 1..142 100 -> Plus
chr3R 9604731..9605686 143..1095 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:13:49 Download gff for LD32260.complete
Subject Subject Range Query Range Percent Splice Strand
CG9288-RA 1..645 324..968 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:27:12 Download gff for LD32260.complete
Subject Subject Range Query Range Percent Splice Strand
CG9288-RA 1..645 324..968 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:03:22 Download gff for LD32260.complete
Subject Subject Range Query Range Percent Splice Strand
CG9288-RA 1..645 324..968 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:54:40 Download gff for LD32260.complete
Subject Subject Range Query Range Percent Splice Strand
CG9288-RA 1..645 324..968 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:26:14 Download gff for LD32260.complete
Subject Subject Range Query Range Percent Splice Strand
CG9288-RA 1..645 324..968 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:03:58 Download gff for LD32260.complete
Subject Subject Range Query Range Percent Splice Strand
CG42375-RA 66..1160 1..1095 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:27:12 Download gff for LD32260.complete
Subject Subject Range Query Range Percent Splice Strand
CG42375-RA 66..1160 1..1095 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:03:22 Download gff for LD32260.complete
Subject Subject Range Query Range Percent Splice Strand
CG9288-RA 23..1117 1..1095 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:54:40 Download gff for LD32260.complete
Subject Subject Range Query Range Percent Splice Strand
CG9288-RA 66..1160 1..1095 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:26:14 Download gff for LD32260.complete
Subject Subject Range Query Range Percent Splice Strand
CG42375-RA 23..1117 1..1095 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:12:59 Download gff for LD32260.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13779646..13779787 1..142 100 -> Plus
3R 13779843..13780795 143..1095 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:12:59 Download gff for LD32260.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13779646..13779787 1..142 100 -> Plus
3R 13779843..13780795 143..1095 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:12:59 Download gff for LD32260.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13779646..13779787 1..142 100 -> Plus
3R 13779843..13780795 143..1095 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:03:22 Download gff for LD32260.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9605368..9605509 1..142 100 -> Plus
arm_3R 9605565..9606517 143..1095 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:30:47 Download gff for LD32260.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13520674..13521626 143..1095 100   Plus
3R 13520477..13520618 1..142 100 -> Plus

LD32260.pep2 Sequence

Translation from 61 to 303

> LD32260.pep2
MHTDLSSHLHTPACNKLIEELQACHENNAFAKFVGVCNSIDDKVVKCLKG
ERIARSAANRAKARERQAKYKEKLLQQESN*

LD32260.pep2 Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 12:18:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18618-PA 79 GF18618-PA 1..77 1..77 369 89.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 12:18:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19826-PA 80 GG19826-PA 1..78 1..78 400 98.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 12:18:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14274-PA 81 GH14274-PA 1..78 1..78 284 82.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:23:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG42375-PA 80 CG42375-PA 1..80 1..80 416 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 12:18:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23166-PA 80 GI23166-PA 1..80 1..80 368 85 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 12:18:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24084-PA 80 GL24084-PA 1..79 1..79 375 87.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 12:18:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26499-PA 80 GA26499-PA 1..79 1..79 375 87.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 12:18:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24132-PA 80 GM24132-PA 1..80 1..80 417 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 12:18:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14481-PA 63 GJ14481-PA 12..63 29..80 226 82.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 12:18:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14199-PA 82 GK14199-PA 1..79 1..79 368 88.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 12:18:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26299-PA 80 GE26299-PA 1..80 1..80 403 96.2 Plus

LD32260.hyp Sequence

Translation from 323 to 967

> LD32260.hyp
MSVQADDPLEPFYFEHEEQEICGKLVAPITDSFQEDYPSVVDRFFTRYYY
FKGDVPYQVLYHSNRICLICLAPEHPALAQGISSVNFDIGNVDRSQNVVK
GKGKKGGMILQAESTLALLTTANGGTYKVPSCIRGKLVEVNTAIVEEPKL
LEQLPEGAGYFAILLPKIENCDAIKASLLTQEQYEERLKSKNEGLPQIES
TGDHAQNKNKEIQA*

LD32260.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:52:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG9288-PA 214 CG9288-PA 1..214 1..214 1114 100 Plus

LD32260.pep Sequence

Translation from 323 to 967

> LD32260.pep
MSVQADDPLEPFYFEHEEQEICGKLVAPITDSFQEDYPSVVDRFFTRYYY
FKGDVPYQVLYHSNRICLICLAPEHPALAQGISSVNFDIGNVDRSQNVVK
GKGKKGGMILQAESTLALLTTANGGTYKVPSCIRGKLVEVNTAIVEEPKL
LEQLPEGAGYFAILLPKIENCDAIKASLLTQEQYEERLKSKNEGLPQIES
TGDHAQNKNKEIQA*

LD32260.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 10:18:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18619-PA 196 GF18619-PA 1..193 1..193 873 85 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 10:18:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19832-PA 208 GG19832-PA 1..208 1..214 903 85 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 10:18:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14275-PA 197 GH14275-PA 1..189 1..188 734 75.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:20:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG9288-PA 214 CG9288-PA 1..214 1..214 1114 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 10:18:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23167-PA 198 GI23167-PA 11..194 6..189 701 72.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 10:18:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24085-PA 219 GL24085-PA 6..193 7..193 824 80.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:18:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21672-PA 219 GA21672-PA 6..193 7..193 824 80.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 10:18:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24134-PA 214 GM24134-PA 1..214 1..214 1039 95.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 10:18:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18931-PA 214 GD18931-PA 1..214 1..214 1044 95.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 10:18:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14482-PA 195 GJ14482-PA 1..191 1..189 741 70.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 10:18:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14200-PA 208 GK14200-PA 10..200 3..193 735 74.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 10:18:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26300-PA 205 GE26300-PA 1..205 1..205 949 91.2 Plus