BDGP Sequence Production Resources |
Search the DGRC for LD32260
Library: | LD |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Ling Hong |
Date Registered: | 1997-12-04 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 322 |
Well: | 60 |
Vector: | pOT2 |
Associated Gene/Transcript | CG42375-RA |
Protein status: | LD32260.pep: gold LD32260.pep2: gold |
Preliminary Size: | 1320 |
Sequenced Size: | 1113 |
Gene | Date | Evidence |
---|---|---|
CG9288 | 2001-01-01 | Release 2 assignment |
CG9288 | 2001-11-29 | Blastp of sequenced clone |
CG9288 | 2003-01-01 | Sim4 clustering to Release 3 |
CG9288 | 2008-04-29 | Release 5.5 accounting |
CG9288 | 2008-08-15 | Release 5.9 accounting |
CG42375 | 2008-12-18 | 5.12 accounting |
CG9288 | 2008-12-18 | 5.12 accounting |
1113 bp (1113 high quality bases) assembled on 2001-11-29
GenBank Submission: AY069582.1
> LD32260.complete TGACAACACACGCGAATCAGGAAAGTGGAAAGGCAATAAACCCGGCCGGA ATCAGGAGAAAATGCATACGGATCTTTCCTCACATCTGCACACGCCCGCT TGCAACAAGTTGATCGAGGAACTCCAGGCCTGCCACGAAAATAACGCCTT CGCAAAATTTGTGGGCGTGTGCAACTCCATTGACGACAAGGTGGTCAAGT GCCTAAAAGGCGAGAGAATCGCCCGATCCGCCGCTAATCGCGCCAAAGCC CGTGAACGTCAGGCGAAGTACAAGGAAAAGTTGCTCCAGCAGGAAAGTAA CTAAAGGAAAGAAATCAACCAGGATGTCAGTACAAGCAGATGATCCACTG GAGCCATTCTACTTCGAGCACGAGGAGCAGGAGATCTGCGGGAAGCTCGT AGCTCCCATTACAGATAGCTTCCAGGAGGATTACCCCAGTGTTGTAGATC GTTTTTTCACCAGATATTACTACTTCAAGGGAGATGTTCCCTACCAAGTG CTCTACCACTCCAATCGCATTTGTCTGATTTGCCTGGCTCCCGAGCACCC TGCTCTAGCTCAAGGCATCTCATCGGTCAACTTTGATATAGGGAACGTAG ATCGCAGCCAGAATGTGGTCAAGGGAAAGGGTAAAAAGGGCGGAATGATC CTACAGGCGGAGTCCACCTTGGCACTGCTCACCACAGCAAATGGAGGGAC TTACAAGGTGCCCAGCTGCATTCGGGGCAAGCTGGTAGAGGTGAACACCG CCATTGTGGAGGAGCCAAAGCTTCTGGAGCAACTCCCCGAGGGAGCCGGC TACTTCGCCATTCTTCTGCCCAAAATCGAAAACTGCGATGCAATCAAGGC GAGTCTTTTAACCCAGGAGCAGTATGAGGAGCGCCTAAAATCGAAAAACG AAGGTCTACCTCAAATTGAGTCCACCGGGGACCACGCTCAAAACAAAAAT AAGGAGATTCAGGCGTGATTTTGACCCTTGTTTTGTTGTGCTTCTTCTAT AAGGCCTTTGTATTTTAAATTAATGATTCATACATATATTATATTGCTCA AAGTCAATGAGGACTTAAATAATAATAATTTTGACAGTAAACCACAAAAA AAAAAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 9604532..9604673 | 1..142 | 100 | -> | Plus |
chr3R | 9604731..9605686 | 143..1095 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9288-RA | 1..645 | 324..968 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9288-RA | 1..645 | 324..968 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9288-RA | 1..645 | 324..968 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9288-RA | 1..645 | 324..968 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9288-RA | 1..645 | 324..968 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42375-RA | 66..1160 | 1..1095 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42375-RA | 66..1160 | 1..1095 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9288-RA | 23..1117 | 1..1095 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG9288-RA | 66..1160 | 1..1095 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG42375-RA | 23..1117 | 1..1095 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 13779646..13779787 | 1..142 | 100 | -> | Plus |
3R | 13779843..13780795 | 143..1095 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 13779646..13779787 | 1..142 | 100 | -> | Plus |
3R | 13779843..13780795 | 143..1095 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 13779646..13779787 | 1..142 | 100 | -> | Plus |
3R | 13779843..13780795 | 143..1095 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 9605368..9605509 | 1..142 | 100 | -> | Plus |
arm_3R | 9605565..9606517 | 143..1095 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 13520674..13521626 | 143..1095 | 100 | Plus | |
3R | 13520477..13520618 | 1..142 | 100 | -> | Plus |
Translation from 61 to 303
> LD32260.pep2 MHTDLSSHLHTPACNKLIEELQACHENNAFAKFVGVCNSIDDKVVKCLKG ERIARSAANRAKARERQAKYKEKLLQQESN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF18618-PA | 79 | GF18618-PA | 1..77 | 1..77 | 369 | 89.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG19826-PA | 80 | GG19826-PA | 1..78 | 1..78 | 400 | 98.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14274-PA | 81 | GH14274-PA | 1..78 | 1..78 | 284 | 82.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG42375-PA | 80 | CG42375-PA | 1..80 | 1..80 | 416 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23166-PA | 80 | GI23166-PA | 1..80 | 1..80 | 368 | 85 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24084-PA | 80 | GL24084-PA | 1..79 | 1..79 | 375 | 87.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA26499-PA | 80 | GA26499-PA | 1..79 | 1..79 | 375 | 87.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM24132-PA | 80 | GM24132-PA | 1..80 | 1..80 | 417 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ14481-PA | 63 | GJ14481-PA | 12..63 | 29..80 | 226 | 82.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK14199-PA | 82 | GK14199-PA | 1..79 | 1..79 | 368 | 88.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE26299-PA | 80 | GE26299-PA | 1..80 | 1..80 | 403 | 96.2 | Plus |
Translation from 323 to 967
> LD32260.hyp MSVQADDPLEPFYFEHEEQEICGKLVAPITDSFQEDYPSVVDRFFTRYYY FKGDVPYQVLYHSNRICLICLAPEHPALAQGISSVNFDIGNVDRSQNVVK GKGKKGGMILQAESTLALLTTANGGTYKVPSCIRGKLVEVNTAIVEEPKL LEQLPEGAGYFAILLPKIENCDAIKASLLTQEQYEERLKSKNEGLPQIES TGDHAQNKNKEIQA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG9288-PA | 214 | CG9288-PA | 1..214 | 1..214 | 1114 | 100 | Plus |
Translation from 323 to 967
> LD32260.pep MSVQADDPLEPFYFEHEEQEICGKLVAPITDSFQEDYPSVVDRFFTRYYY FKGDVPYQVLYHSNRICLICLAPEHPALAQGISSVNFDIGNVDRSQNVVK GKGKKGGMILQAESTLALLTTANGGTYKVPSCIRGKLVEVNTAIVEEPKL LEQLPEGAGYFAILLPKIENCDAIKASLLTQEQYEERLKSKNEGLPQIES TGDHAQNKNKEIQA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF18619-PA | 196 | GF18619-PA | 1..193 | 1..193 | 873 | 85 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG19832-PA | 208 | GG19832-PA | 1..208 | 1..214 | 903 | 85 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14275-PA | 197 | GH14275-PA | 1..189 | 1..188 | 734 | 75.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG9288-PA | 214 | CG9288-PA | 1..214 | 1..214 | 1114 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23167-PA | 198 | GI23167-PA | 11..194 | 6..189 | 701 | 72.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24085-PA | 219 | GL24085-PA | 6..193 | 7..193 | 824 | 80.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA21672-PA | 219 | GA21672-PA | 6..193 | 7..193 | 824 | 80.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM24134-PA | 214 | GM24134-PA | 1..214 | 1..214 | 1039 | 95.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD18931-PA | 214 | GD18931-PA | 1..214 | 1..214 | 1044 | 95.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ14482-PA | 195 | GJ14482-PA | 1..191 | 1..189 | 741 | 70.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK14200-PA | 208 | GK14200-PA | 10..200 | 3..193 | 735 | 74.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE26300-PA | 205 | GE26300-PA | 1..205 | 1..205 | 949 | 91.2 | Plus |