Clone LD32381 Report

Search the DGRC for LD32381

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:323
Well:81
Vector:pOT2
Associated Gene/TranscriptCG11975-RA
Protein status:LD32381.pep: gold
Preliminary Size:1475
Sequenced Size:1419

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11975 2001-01-01 Release 2 assignment
CG11975 2003-01-01 Sim4 clustering to Release 3
CG11975 2005-03-17 Blastp of sequenced clone
CG11975 2008-04-29 Release 5.5 accounting
CG11975 2008-08-15 Release 5.9 accounting
CG11975 2008-12-18 5.12 accounting

Clone Sequence Records

LD32381.complete Sequence

1419 bp (1419 high quality bases) assembled on 2005-03-17

GenBank Submission: BT021959

> LD32381.complete
AAAAAACACAATCATCCGCCGTCCGAGCAATTGTTTTCCTGCCTGCCCAG
CAACTGTATTGAAAATCACCAGAGCCCGGGCTTCCAGCATCCCCGGAGAG
TGCAATGAACCTCACAGAGCAAAACCCATATGGAAACGGGCTGCTCTACG
CAGCCTTCAATCAAGACCAAGGATGCTTCGCGTGCGCGACGGACACCGGA
TTCCGGGTCTACAACTGTGATCCGCTGAAGGAGAAGGAGCGCCAATACTT
TCCAGAGGGTGGTCTCAGCCATGTGGAGATGCTGTTTCGTTGCAATTACT
TAGCCCTGGTTGGAGGCGGCATCCGGCCGCTGTACCCGCCCAACAAGGTG
ATCGTGTGGGATGACCTGAAGAAGTCCCCGGCCATATCGCTGGACTTCAA
TCAGCCCGTGCGGGCGGTACGACTGCGTCGGGATCGCATCGTGGTCGTGT
TGGAGGGCGTGATTAAGGTGTTCACCTTCACTCAGCAACCACAGCAGCTG
CACGTCTTTGAGACCAGCTCAAATCCCAACGGGCTGTGTGTGCTGTGCCC
GCACAGCAATAAGAGCCTCCTCGCATTCCCCGGCCGTCGAACTGGCCACG
TTCAAATTGTTGATCTGGCCAACACAGAGCGGGCGCCGCTTGAGGTGATC
GCCCACGAGGCTGGTATCAGCTGTATTGCCCTTAATCTGCAAGGCACGCG
ACTAGCCACCGCCGGGGAAAAGGGCACCCTCATCCGTATCTTCGATACGG
AAAGTGGCAAGAAGGTATCAGAGCTGAGGCGCGGAAGCAACCACGCCAAC
ATATTCTGCATCAACTTTAACCACCAGTCCACAATGGTGGTCGTCGCCTC
CGATCATGGCACCATACACGTCTTCAACCTGGAGGACAACAAGCCCCGTG
AATCCTCGCTGCCCATAATACCCAAGTATTTCTCGAGCCAGTGGAGTTTT
GTCAAGTTTTCAATACCCCAGGGACCTCGATGTGTATGTGCCTTTGGCGC
CGATCCTAATTCGGTTGTGGCCATTTGTGCAGACGGCCACTATTATAAAT
TCCTATTTAACAATAAAGGCGAGTGCAGTCGAGACATCTGCACACAATTC
CTTGAGCTGCAAGACGATGAGACCTAGAAACAAATCCGATTGTTGCGAAC
GCCTTTGATGCATCTATACAATTATATATCTCCATGGAAATGTGTTATAC
AATATTACTTATAAGCATGCTTTAAAATACGTTAAAAGTCGAGTTCACAT
AAATGTAGTTATACCTTGAGACATGATTGTGGATATTTTATATTTTATTT
GAAACATAAACCGATAATCCAACATGCTCATTTAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAA

LD32381.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:40:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG11975-RA 1893 CG11975-RA 157..1491 1..1335 6675 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:01:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 4819589..4820351 258..1020 3815 100 Plus
chr3R 27901430 chr3R 4820417..4820730 1020..1333 1555 99.7 Plus
chr3R 27901430 chr3R 4819171..4819339 1..169 845 100 Plus
chr3R 27901430 chr3R 4819425..4819515 170..260 455 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:26:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:01:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8993698..8994460 258..1020 3815 100 Plus
3R 32079331 3R 8994526..8994841 1020..1335 1580 100 Plus
3R 32079331 3R 8993280..8993451 1..172 860 100 Plus
3R 32079331 3R 8993534..8993624 170..260 455 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:30:52
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 8734529..8735291 258..1020 3815 100 Plus
3R 31820162 3R 8735357..8735672 1020..1335 1580 100 Plus
3R 31820162 3R 8734111..8734282 1..172 860 100 Plus
3R 31820162 3R 8734365..8734455 170..260 455 100 Plus
Blast to na_te.dros performed 2019-03-16 04:01:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Ulysses 10653 Dvir\Ulysses DVULYSS 10653bp AKA(S37633) Derived from X56645 (Rel. 38, Last updated, Version 6). 5793..5840 327..374 141 77.1 Plus

LD32381.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:01:57 Download gff for LD32381.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 4819171..4819341 1..171 99 -> Plus
chr3R 4819427..4819513 172..258 100 -> Plus
chr3R 4819590..4820351 259..1020 100 -> Plus
chr3R 4820418..4820730 1021..1333 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:13:57 Download gff for LD32381.complete
Subject Subject Range Query Range Percent Splice Strand
CG11975-RA 1..1023 105..1127 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:07:34 Download gff for LD32381.complete
Subject Subject Range Query Range Percent Splice Strand
CG11975-RA 1..1023 105..1127 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:12:45 Download gff for LD32381.complete
Subject Subject Range Query Range Percent Splice Strand
CG11975-RA 1..1023 105..1127 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:52:29 Download gff for LD32381.complete
Subject Subject Range Query Range Percent Splice Strand
CG11975-RA 1..1023 105..1127 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:23:13 Download gff for LD32381.complete
Subject Subject Range Query Range Percent Splice Strand
CG11975-RA 1..1023 105..1127 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:57:46 Download gff for LD32381.complete
Subject Subject Range Query Range Percent Splice Strand
CG11975-RA 24..1356 1..1333 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:07:34 Download gff for LD32381.complete
Subject Subject Range Query Range Percent Splice Strand
CG11975-RA 24..1356 1..1333 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:12:45 Download gff for LD32381.complete
Subject Subject Range Query Range Percent Splice Strand
CG11975-RA 28..1360 1..1333 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:52:30 Download gff for LD32381.complete
Subject Subject Range Query Range Percent Splice Strand
CG11975-RA 24..1356 1..1333 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:23:13 Download gff for LD32381.complete
Subject Subject Range Query Range Percent Splice Strand
CG11975-RA 28..1360 1..1333 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:01:57 Download gff for LD32381.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8994527..8994839 1021..1333 100   Plus
3R 8993280..8993450 1..171 100 -> Plus
3R 8993536..8993622 172..258 100 -> Plus
3R 8993699..8994460 259..1020 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:01:57 Download gff for LD32381.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8994527..8994839 1021..1333 100   Plus
3R 8993280..8993450 1..171 100 -> Plus
3R 8993536..8993622 172..258 100 -> Plus
3R 8993699..8994460 259..1020 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:01:57 Download gff for LD32381.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8994527..8994839 1021..1333 100   Plus
3R 8993280..8993450 1..171 100 -> Plus
3R 8993536..8993622 172..258 100 -> Plus
3R 8993699..8994460 259..1020 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:12:45 Download gff for LD32381.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4820249..4820561 1021..1333 100   Plus
arm_3R 4819002..4819172 1..171 100 -> Plus
arm_3R 4819258..4819344 172..258 100 -> Plus
arm_3R 4819421..4820182 259..1020 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:27:26 Download gff for LD32381.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8734530..8735291 259..1020 100 -> Plus
3R 8735358..8735670 1021..1333 100   Plus
3R 8734111..8734281 1..171 100 -> Plus
3R 8734367..8734453 172..258 100 -> Plus

LD32381.pep Sequence

Translation from 104 to 1126

> LD32381.pep
MNLTEQNPYGNGLLYAAFNQDQGCFACATDTGFRVYNCDPLKEKERQYFP
EGGLSHVEMLFRCNYLALVGGGIRPLYPPNKVIVWDDLKKSPAISLDFNQ
PVRAVRLRRDRIVVVLEGVIKVFTFTQQPQQLHVFETSSNPNGLCVLCPH
SNKSLLAFPGRRTGHVQIVDLANTERAPLEVIAHEAGISCIALNLQGTRL
ATAGEKGTLIRIFDTESGKKVSELRRGSNHANIFCINFNHQSTMVVVASD
HGTIHVFNLEDNKPRESSLPIIPKYFSSQWSFVKFSIPQGPRCVCAFGAD
PNSVVAICADGHYYKFLFNNKGECSRDICTQFLELQDDET*

LD32381.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:41:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16573-PA 340 GF16573-PA 1..340 1..340 1804 98.2 Plus
Dana\GF25099-PA 433 GF25099-PA 2..341 1..316 290 27.5 Plus
Dana\GF15570-PA 472 GF15570-PA 16..241 29..260 212 27.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:41:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14096-PA 340 GG14096-PA 1..340 1..340 1830 100 Plus
Dere\GG14476-PA 435 GG14476-PA 2..341 1..316 295 27.2 Plus
Dere\GG21513-PA 471 GG21513-PA 8..244 18..260 228 29.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:41:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19377-PA 340 GH19377-PA 1..340 1..340 1781 96.2 Plus
Dgri\GH15493-PA 437 GH15493-PA 2..339 1..316 291 27.3 Plus
Dgri\GH11033-PA 479 GH11033-PA 12..249 32..274 187 27.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:22:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG11975-PB 340 CG11975-PB 1..340 1..340 1816 100 Plus
CG11975-PA 340 CG11975-PA 1..340 1..340 1816 100 Plus
Atg18a-PG 377 CG7986-PG 2..286 1..285 291 29.8 Plus
Atg18a-PC 377 CG7986-PC 2..286 1..285 291 29.8 Plus
Atg18a-PB 377 CG7986-PB 2..286 1..285 291 29.8 Plus
Atg18a-PA 377 CG7986-PA 2..286 1..285 291 29.8 Plus
Atg18a-PE 447 CG7986-PE 2..286 1..285 291 29.8 Plus
Atg18a-PF 372 CG7986-PF 2..341 1..316 290 27.5 Plus
Atg18a-PD 435 CG7986-PD 2..341 1..316 290 27.5 Plus
Atg18b-PB 471 CG8678-PB 8..244 18..260 229 27.2 Plus
Atg18b-PA 471 CG8678-PA 8..244 18..260 229 27.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:41:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22579-PA 340 GI22579-PA 1..340 1..340 1791 96.8 Plus
Dmoj\GI16769-PA 431 GI16769-PA 2..339 1..316 264 27 Plus
Dmoj\GI17552-PA 462 GI17552-PA 9..259 29..284 191 27.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:41:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12110-PA 340 GL12110-PA 1..340 1..340 1818 98.8 Plus
Dper\GL22534-PA 444 GL22534-PA 2..339 1..316 300 28.2 Plus
Dper\GL26366-PA 505 GL26366-PA 57..310 32..291 200 26.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:41:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11305-PA 340 GA11305-PA 1..340 1..340 1818 98.8 Plus
Dpse\GA20742-PA 442 GA20742-PA 2..339 1..316 300 28.2 Plus
Dpse\GA21256-PA 470 GA21256-PA 8..244 18..260 214 28.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:41:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23775-PA 340 GM23775-PA 1..340 1..340 1830 100 Plus
Dsec\GM25025-PA 435 GM25025-PA 2..341 1..316 297 27.2 Plus
Dsec\GM23265-PA 471 GM23265-PA 8..244 18..260 221 28.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:41:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18585-PA 340 GD18585-PA 1..340 1..340 1830 100 Plus
Dsim\GD14059-PA 435 GD14059-PA 2..341 1..316 296 27.7 Plus
Dsim\GD21643-PA 549 GD21643-PA 99..322 31..260 210 28.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:41:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10301-PA 340 GJ10301-PA 1..340 1..340 1789 96.5 Plus
Dvir\GJ12513-PA 443 GJ12513-PA 2..339 1..316 280 27 Plus
Dvir\GJ15537-PA 470 GJ15537-PA 11..251 29..274 193 27.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:41:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11674-PA 340 GK11674-PA 1..340 1..340 1754 94.7 Plus
Dwil\GK11999-PA 451 GK11999-PA 2..339 1..316 301 27.6 Plus
Dwil\GK14682-PA 474 GK14682-PA 10..244 31..272 205 27.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:41:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25918-PA 340 GE25918-PA 1..340 1..340 1830 100 Plus
Dyak\GE21663-PA 435 GE21663-PA 2..341 1..316 294 27.5 Plus
Dyak\GE12992-PA 471 GE12992-PA 8..244 18..260 225 29 Plus

LD32381.hyp Sequence

Translation from 104 to 1126

> LD32381.hyp
MNLTEQNPYGNGLLYAAFNQDQGCFACATDTGFRVYNCDPLKEKERQYFP
EGGLSHVEMLFRCNYLALVGGGIRPLYPPNKVIVWDDLKKSPAISLDFNQ
PVRAVRLRRDRIVVVLEGVIKVFTFTQQPQQLHVFETSSNPNGLCVLCPH
SNKSLLAFPGRRTGHVQIVDLANTERAPLEVIAHEAGISCIALNLQGTRL
ATAGEKGTLIRIFDTESGKKVSELRRGSNHANIFCINFNHQSTMVVVASD
HGTIHVFNLEDNKPRESSLPIIPKYFSSQWSFVKFSIPQGPRCVCAFGAD
PNSVVAICADGHYYKFLFNNKGECSRDICTQFLELQDDET*

LD32381.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:02:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG11975-PB 340 CG11975-PB 1..340 1..340 1816 100 Plus
CG11975-PA 340 CG11975-PA 1..340 1..340 1816 100 Plus
Atg18a-PG 377 CG7986-PG 2..286 1..285 291 29.8 Plus
Atg18a-PC 377 CG7986-PC 2..286 1..285 291 29.8 Plus
Atg18a-PB 377 CG7986-PB 2..286 1..285 291 29.8 Plus