Clone LD32459 Report

Search the DGRC for LD32459

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:324
Well:59
Vector:pOT2
Associated Gene/TranscriptCG8435-RA
Protein status:LD32459.pep: gold
Preliminary Size:1306
Sequenced Size:1151

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8435 2001-01-01 Release 2 assignment
CG8435 2002-05-17 Blastp of sequenced clone
CG8435 2003-01-01 Sim4 clustering to Release 3
CG8435 2008-04-29 Release 5.5 accounting
CG8435 2008-08-15 Release 5.9 accounting
CG8435 2008-12-18 5.12 accounting

Clone Sequence Records

LD32459.complete Sequence

1151 bp (1151 high quality bases) assembled on 2002-05-17

GenBank Submission: AY118949

> LD32459.complete
CACTGTTAGGCAGATAAATAAATTGTATTTATTTTAGTAAGAAATAAATC
GTAGTCTTCAAAATGTCCGAGCGAAAGGTCTTAAACAAATACTATCCCCC
GGACTTCGATCCATCGAAGATTCCGCGCATGAAACTGGCCAAAAACCGGC
AGTACACCGTGAGATTGATGGCTCCATTTAATATGCGCTGCAAAACGTGT
GGGGAATACATATACAAGGGCAAGAAATTCAACGCTCGCAAGGAGGACGT
GGAGAACGAAACGTACCTGGGCATCAGGATCTATCGGTTCTACATCAAGT
GCACGCGCTGCCTGCAGGAGATCTCCTTCAAGACAGATCCACAGAACACG
GACTACGAGATTGAGGCGGGGGCCACCAGGAATTTCATGGCACTCAAGTT
GGCCGAGGAACAGGCACGTCGCGAGGAGCAGGAATTGCGCGATGAGGAGG
CCAACAATCCGATGAAGCTGCTCGAGAATCGCACCCAACAGTCGCGCAAC
GAGATCGAAACGATCGAGAGCCTGGAGGAGTTGCGTGATCTCAACCGGCG
TCAGCAGACAGTGGACTACAACACTCTGCTGCAGCAGTACAACACGGTGG
AGACGGAGAGAGAGCGCCAGGAGCGGGAGGAGCGCGAAGACGAGGATTTT
ATTAAGTCCGTAAACTTTAAGAACAAGCCAGAAGGAAGCTCTCGTGTTGT
CGCTGAGGAAATCATTGAGGAGATCAAGGATGAACCGTTGGACACACCGT
CAGCTCCTCCACCAGCCAAACAGGCCAAGCCCAGCACGATCAGTCTTTCC
GCCACATCCTCCAGCAAAGCATCCGCAGCGCAGTCAATGGTTAAAAGGAA
GACACCATTGGTGCTGGTCAAGCCCAAGGCAACCGCAGTAGCAAAGCCCA
CGGTAGCCACTGGAACGACGCAAGTTGAATCCAAACCAGCCGCAACCACG
CCCTCAGTTGTGTCTGCACCAGCGGAAACTAAAGCTACAAATCAGCCAGC
TGCCGCTCCAGCTGGACTTTCCCTCTTGGCTGCCTACAGTGACAGCTCAG
AGGATTCCAACTGACCAAGCATTTACCTGATGACACACTTACAACTCGAA
GACAGATTAAAGCAAGTTCAAATAATAAAAGCAAAAAAAAAAAAAAAAAA
A

LD32459.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:55:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG8435-RA 1322 CG8435-RA 91..1223 1..1133 5665 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:05:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 12057457..12058027 657..87 2855 100 Minus
chr2R 21145070 chr2R 12056922..12057402 1132..652 2390 99.8 Minus
chr2R 21145070 chr2R 12058082..12058167 86..1 430 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:26:29 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:05:49
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16170135..16170705 657..87 2855 100 Minus
2R 25286936 2R 16169599..16170080 1133..652 2395 99.8 Minus
2R 25286936 2R 16170760..16170845 86..1 430 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:14:32
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 16171334..16171904 657..87 2855 100 Minus
2R 25260384 2R 16170798..16171279 1133..652 2395 99.7 Minus
2R 25260384 2R 16171959..16172044 86..1 430 100 Minus
Blast to na_te.dros performed 2019-03-16 11:05:50
Subject Length Description Subject Range Query Range Score Percent Strand
S-element 1736 S-element DM33463 1736bp Derived from U33463 (g1006788) (Rel. 47, Last updated, Version 5). 107..192 12..96 121 61.6 Plus
S-element 1736 S-element DM33463 1736bp Derived from U33463 (g1006788) (Rel. 47, Last updated, Version 5). 1545..1630 96..12 121 61.6 Minus
Dhet\Uhu 1658 Dhet\Uhu DHUHUH3 1658bp AKA(S51651) Derived from X63028 (Rel. 36, Last updated, Version 7). 1489..1536 15..62 114 70.8 Plus

LD32459.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:06:44 Download gff for LD32459.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 12056922..12057398 656..1132 100 <- Minus
chr2R 12057459..12058027 87..655 100 <- Minus
chr2R 12058082..12058167 1..86 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:14:02 Download gff for LD32459.complete
Subject Subject Range Query Range Percent Splice Strand
CG8435-RA 1..1002 63..1064 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:52:58 Download gff for LD32459.complete
Subject Subject Range Query Range Percent Splice Strand
CG8435-RA 1..1002 63..1064 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:31:31 Download gff for LD32459.complete
Subject Subject Range Query Range Percent Splice Strand
CG8435-RA 1..1002 63..1064 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:35:25 Download gff for LD32459.complete
Subject Subject Range Query Range Percent Splice Strand
CG8435-RA 1..1002 63..1064 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:26:22 Download gff for LD32459.complete
Subject Subject Range Query Range Percent Splice Strand
CG8435-RA 1..1002 63..1064 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:04:58 Download gff for LD32459.complete
Subject Subject Range Query Range Percent Splice Strand
CG8435-RA 5..1136 1..1132 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:52:58 Download gff for LD32459.complete
Subject Subject Range Query Range Percent Splice Strand
CG8435-RA 16..1147 1..1132 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:31:31 Download gff for LD32459.complete
Subject Subject Range Query Range Percent Splice Strand
CG8435-RA 17..1148 1..1132 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:35:25 Download gff for LD32459.complete
Subject Subject Range Query Range Percent Splice Strand
CG8435-RA 5..1136 1..1132 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:26:22 Download gff for LD32459.complete
Subject Subject Range Query Range Percent Splice Strand
CG8435-RA 17..1148 1..1132 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:06:44 Download gff for LD32459.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16169600..16170076 656..1132 100 <- Minus
2R 16170137..16170705 87..655 100 <- Minus
2R 16170760..16170845 1..86 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:06:44 Download gff for LD32459.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16169600..16170076 656..1132 100 <- Minus
2R 16170137..16170705 87..655 100 <- Minus
2R 16170760..16170845 1..86 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:06:44 Download gff for LD32459.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16169600..16170076 656..1132 100 <- Minus
2R 16170137..16170705 87..655 100 <- Minus
2R 16170760..16170845 1..86 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:31:31 Download gff for LD32459.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12057105..12057581 656..1132 100 <- Minus
arm_2R 12057642..12058210 87..655 100 <- Minus
arm_2R 12058265..12058350 1..86 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:17:39 Download gff for LD32459.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16170799..16171275 656..1132 100 <- Minus
2R 16171336..16171904 87..655 100 <- Minus
2R 16171959..16172044 1..86 100   Minus

LD32459.hyp Sequence

Translation from 62 to 1063

> LD32459.hyp
MSERKVLNKYYPPDFDPSKIPRMKLAKNRQYTVRLMAPFNMRCKTCGEYI
YKGKKFNARKEDVENETYLGIRIYRFYIKCTRCLQEISFKTDPQNTDYEI
EAGATRNFMALKLAEEQARREEQELRDEEANNPMKLLENRTQQSRNEIET
IESLEELRDLNRRQQTVDYNTLLQQYNTVETERERQEREEREDEDFIKSV
NFKNKPEGSSRVVAEEIIEEIKDEPLDTPSAPPPAKQAKPSTISLSATSS
SKASAAQSMVKRKTPLVLVKPKATAVAKPTVATGTTQVESKPAATTPSVV
SAPAETKATNQPAAAPAGLSLLAAYSDSSEDSN*

LD32459.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:11:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG8435-PA 333 CG8435-PA 1..333 1..333 1687 100 Plus
CG15084-PA 316 CG15084-PA 1..204 1..195 185 26.9 Plus

LD32459.pep Sequence

Translation from 62 to 1063

> LD32459.pep
MSERKVLNKYYPPDFDPSKIPRMKLAKNRQYTVRLMAPFNMRCKTCGEYI
YKGKKFNARKEDVENETYLGIRIYRFYIKCTRCLQEISFKTDPQNTDYEI
EAGATRNFMALKLAEEQARREEQELRDEEANNPMKLLENRTQQSRNEIET
IESLEELRDLNRRQQTVDYNTLLQQYNTVETERERQEREEREDEDFIKSV
NFKNKPEGSSRVVAEEIIEEIKDEPLDTPSAPPPAKQAKPSTISLSATSS
SKASAAQSMVKRKTPLVLVKPKATAVAKPTVATGTTQVESKPAATTPSVV
SAPAETKATNQPAAAPAGLSLLAAYSDSSEDSN*

LD32459.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:44:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13045-PA 332 GF13045-PA 1..332 1..333 1118 81.7 Plus
Dana\GF11122-PA 316 GF11122-PA 1..116 1..106 187 34.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:44:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22298-PA 338 GG22298-PA 1..338 1..333 1300 91.7 Plus
Dere\GG21932-PA 316 GG21932-PA 1..116 1..106 188 34.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:44:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23000-PA 330 GH23000-PA 1..330 1..333 1142 77.1 Plus
Dgri\GH22130-PA 368 GH22130-PA 1..204 1..195 211 30.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:15:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG8435-PA 333 CG8435-PA 1..333 1..333 1687 100 Plus
CG15084-PA 316 CG15084-PA 1..204 1..195 185 26.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:44:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18966-PA 349 GI18966-PA 1..349 1..333 1075 73.3 Plus
Dmoj\GI19358-PA 409 GI19358-PA 1..195 1..187 204 30 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:44:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11393-PA 319 GL11393-PA 1..318 1..332 1090 77.7 Plus
Dper\GL11492-PA 317 GL11492-PA 1..116 1..106 195 36.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:44:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21076-PA 319 GA21076-PA 1..318 1..332 1044 74.1 Plus
Dpse\GA13478-PA 317 GA13478-PA 1..116 1..106 195 36.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:44:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20087-PA 333 GM20087-PA 1..333 1..333 1686 96.4 Plus
Dsec\GM21922-PA 316 GM21922-PA 1..116 1..106 190 34.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:44:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25564-PA 333 GD25564-PA 1..333 1..333 1481 96.1 Plus
Dsim\GD11416-PA 316 GD11416-PA 1..116 1..106 190 34.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:44:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20909-PA 315 GJ20909-PA 1..315 1..333 1058 78.7 Plus
Dvir\GJ19913-PA 366 GJ19913-PA 1..195 1..187 201 30 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:44:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15812-PA 337 GK15812-PA 1..337 1..333 1106 77.2 Plus
Dwil\GK20930-PA 318 GK20930-PA 1..116 1..106 198 36.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:44:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14094-PA 338 GE14094-PA 1..338 1..333 1162 90.5 Plus
Dyak\GE12005-PA 316 GE12005-PA 1..116 1..106 187 34.7 Plus