Clone LD32469 Report

Search the DGRC for LD32469

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:324
Well:69
Vector:pOT2
Associated Gene/TranscriptSC35-RB
Protein status:LD32469.pep: gold
Preliminary Size:1184
Sequenced Size:1055

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5442 2001-01-01 Release 2 assignment
CG5442 2001-11-29 Blastp of sequenced clone
CG5442 2003-01-01 Sim4 clustering to Release 3
SC35 2008-04-29 Release 5.5 accounting
SC35 2008-08-15 Release 5.9 accounting
SC35 2008-12-18 5.12 accounting

Clone Sequence Records

LD32469.complete Sequence

1055 bp (1055 high quality bases) assembled on 2001-11-29

GenBank Submission: AY069584

> LD32469.complete
AGTTTGGCTCGTTTTCAGCATTCGCATTAGCATTTTAGCGGTAAAACAAA
TATCCAAATAGACAATGAGCAACGGTGGTGGTGCCGGGGGATTGGGCGCA
GCGCGTCCACCTCCACGGATCGATGGAATGGTCTCGCTTAAGGTCGACAA
TCTCACATATCGCACCACGCCGGAGGATCTGCGTCGGGTCTTCGAGCGGT
GCGGCGAGGTGGGGGACATCTACATACCCAGGGATCGCTACACACGTGAG
AGCCGCGGATTCGCATTTGTTCGCTTCTATGACAAACGTGATGCCGAGGA
CGCACTGGAGGCCATGGATGGTCGCATGCTAGACGGCAGGGAGCTCCGCG
TACAGATGGCCCGCTACGGACGCCCCTCTTCGCCCACTCGCAGCTCCAGT
GGTCGTCGTGGCGGAGGAGGAGGCGGTGGTTCCGGCGGGCGTCGTCGGTC
ACGTTCTCGCTCCCCAATGCGCCGTCGTTCGCGCAGTCCGCGTCGCCGAT
CATACTCCCGTTCCCGCTCGCCTGGTAGCCACTCGCCGGAACGCCGATCC
AAATTTTCACGCAGTCCAGTACGCGGCGACAGCCGCAATGGAATCGGAAG
CGGATCTGGAGGACTGGCCCCAGCCGCGTCTCGTAGTCGCAGTCGCTCCT
AGATATCGACGTCACGTTCCATTTAGTGGGAGTGCGAGATATGACTCGCT
GACTAGGGCCAATGCTGTATCCTGTTCCGGATCTATGGCTCCATCTGTGT
CATGCTGTACCCGAACAGCAGGTATAGAAACCATTATACAATCTTACACT
TAACACAACTATTTATAGCGAACTATTTTAAGTTTCGGCAGAGTAAATAA
GTAGAGATCAGGCATGATTATGTTCCGAGTGAGATCCCCGCAACCTGGGC
GATCCCTCGATGTCGGTTCTTGCACATAGGCTTTCATATACTAGAGCGTA
GTAGAAATCCTTGAACGTAATCAGAAACAGAACAAAATAAACTCAAATTA
ACACGGCTTCAATTCAAAAAAAAAAAATAAAAAAAAAAAAAAAAAAAAAA
AAAAA

LD32469.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:52:32
Subject Length Description Subject Range Query Range Score Percent Strand
SC35-RB 1420 SC35-RB 153..1169 1..1017 5085 100 Plus
SC35.a 2029 SC35.a 147..1163 1..1017 5085 100 Plus
SC35-RA 1002 SC35-RA 106..982 141..1017 4385 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:14:52
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 12430926..12431349 688..265 2090 99.5 Minus
chr2L 23010047 chr2L 12430493..12430823 1017..687 1655 100 Minus
chr2L 23010047 chr2L 12432451..12432593 143..1 715 100 Minus
chr2L 23010047 chr2L 12432196..12432328 273..141 665 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:26:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:14:50
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12432309..12432732 688..265 2090 99.5 Minus
2L 23513712 2L 12431876..12432206 1017..687 1655 100 Minus
2L 23513712 2L 12433834..12433976 143..1 715 100 Minus
2L 23513712 2L 12433579..12433711 273..141 665 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:18:18
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 12432309..12432732 688..265 2090 99.5 Minus
2L 23513712 2L 12431876..12432206 1017..687 1655 100 Minus
2L 23513712 2L 12433834..12433976 143..1 715 100 Minus
2L 23513712 2L 12433579..12433711 273..141 665 100 Minus
Blast to na_te.dros performed 2019-03-16 04:14:51
Subject Length Description Subject Range Query Range Score Percent Strand
McClintock 6450 McClintock McCLINTOCK 6450bp 2659..2711 973..1025 112 67.9 Plus

LD32469.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:15:45 Download gff for LD32469.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 12432452..12432593 1..142 100   Minus
chr2L 12430495..12430821 689..1015 100 <- Minus
chr2L 12430926..12431340 274..688 100 <- Minus
chr2L 12432196..12432326 143..273 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:14:03 Download gff for LD32469.complete
Subject Subject Range Query Range Percent Splice Strand
SC35-RB 1..588 65..652 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:22:37 Download gff for LD32469.complete
Subject Subject Range Query Range Percent Splice Strand
SC35-RC 1..588 65..652 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:22:54 Download gff for LD32469.complete
Subject Subject Range Query Range Percent Splice Strand
SC35-RB 1..588 65..652 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:48:59 Download gff for LD32469.complete
Subject Subject Range Query Range Percent Splice Strand
SC35-RB 1..588 65..652 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:32:53 Download gff for LD32469.complete
Subject Subject Range Query Range Percent Splice Strand
SC35-RB 1..588 65..652 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:57:20 Download gff for LD32469.complete
Subject Subject Range Query Range Percent Splice Strand
SC35-RB 70..1084 1..1015 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:22:36 Download gff for LD32469.complete
Subject Subject Range Query Range Percent Splice Strand
SC35-RB 70..1084 1..1015 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:22:54 Download gff for LD32469.complete
Subject Subject Range Query Range Percent Splice Strand
SC35-RD 63..1077 1..1015 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:48:59 Download gff for LD32469.complete
Subject Subject Range Query Range Percent Splice Strand
SC35-RB 70..1084 1..1015 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:32:53 Download gff for LD32469.complete
Subject Subject Range Query Range Percent Splice Strand
SC35-RD 63..1077 1..1015 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:15:45 Download gff for LD32469.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12431878..12432204 689..1015 100 <- Minus
2L 12432309..12432723 274..688 100 <- Minus
2L 12433579..12433709 143..273 100 <- Minus
2L 12433835..12433976 1..142 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:15:45 Download gff for LD32469.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12431878..12432204 689..1015 100 <- Minus
2L 12432309..12432723 274..688 100 <- Minus
2L 12433579..12433709 143..273 100 <- Minus
2L 12433835..12433976 1..142 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:15:45 Download gff for LD32469.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12431878..12432204 689..1015 100 <- Minus
2L 12432309..12432723 274..688 100 <- Minus
2L 12433579..12433709 143..273 100 <- Minus
2L 12433835..12433976 1..142 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:22:54 Download gff for LD32469.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 12431878..12432204 689..1015 100 <- Minus
arm_2L 12432309..12432723 274..688 100 <- Minus
arm_2L 12433579..12433709 143..273 100 <- Minus
arm_2L 12433835..12433976 1..142 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:25:33 Download gff for LD32469.complete
Subject Subject Range Query Range Percent Splice Strand
2L 12431878..12432204 689..1015 100 <- Minus
2L 12432309..12432723 274..688 100 <- Minus
2L 12433579..12433709 143..273 100 <- Minus
2L 12433835..12433976 1..142 100   Minus

LD32469.pep Sequence

Translation from 64 to 651

> LD32469.pep
MSNGGGAGGLGAARPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVG
DIYIPRDRYTRESRGFAFVRFYDKRDAEDALEAMDGRMLDGRELRVQMAR
YGRPSSPTRSSSGRRGGGGGGGSGGRRRSRSRSPMRRRSRSPRRRSYSRS
RSPGSHSPERRSKFSRSPVRGDSRNGIGSGSGGLAPAASRSRSRS*

LD32469.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:42:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15672-PA 199 GF15672-PA 1..105 1..108 527 96.3 Plus
Dana\GF16759-PA 154 GF16759-PA 31..105 24..98 148 38.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:42:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10262-PA 195 GG10262-PA 1..195 1..195 927 99.5 Plus
Dere\GG22670-PA 154 GG22670-PA 28..103 21..96 151 39.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:42:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11678-PA 203 GH11678-PA 1..104 1..104 495 95.2 Plus
Dgri\GH15101-PA 154 GH15101-PA 31..105 24..98 148 38.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:14:49
Subject Length Description Subject Range Query Range Score Percent Strand
SC35-PD 195 CG5442-PD 1..195 1..195 1009 100 Plus
SC35-PC 195 CG5442-PC 1..195 1..195 1009 100 Plus
SC35-PB 195 CG5442-PB 1..195 1..195 1009 100 Plus
SC35-PA 112 CG5442-PA 1..112 84..195 571 100 Plus
Rbp1-PA 135 CG17136-PA 15..134 27..160 222 42.5 Plus
RnpS1-PA 374 CG16788-PA 214..372 15..157 199 37.7 Plus
Rbp1-like-PC 158 CG1987-PC 15..157 27..160 195 36.2 Plus
Rbp1-like-PA 158 CG1987-PA 15..157 27..160 195 36.2 Plus
B52-PN 350 CG10851-PN 93..278 5..195 195 37.4 Plus
B52-PC 350 CG10851-PC 93..278 5..195 195 37.4 Plus
B52-PA 350 CG10851-PA 93..278 5..195 195 37.4 Plus
B52-PB 329 CG10851-PB 93..283 4..195 191 36.5 Plus
B52-PO 355 CG10851-PO 93..283 4..195 191 36.5 Plus
B52-PM 355 CG10851-PM 93..283 4..195 191 36.5 Plus
x16-PB 257 CG10203-PB 12..184 27..195 180 33.5 Plus
Rsf1-PB 200 CG5655-PB 14..193 27..195 174 34 Plus
Rsf1-PA 200 CG5655-PA 14..193 27..195 174 34 Plus
x16-PA 258 CG10203-PA 12..185 27..195 174 33.9 Plus
Rox8-PC 464 CG5422-PC 86..196 14..124 173 35.1 Plus
Rox8-PB 464 CG5422-PB 86..196 14..124 173 35.1 Plus
Rox8-PH 470 CG5422-PH 86..196 14..124 173 35.1 Plus
Rox8-PG 470 CG5422-PG 86..196 14..124 173 35.1 Plus
Rox8-PE 470 CG5422-PE 86..196 14..124 173 35.1 Plus
Rox8-PD 470 CG5422-PD 86..196 14..124 173 35.1 Plus
Rbp1-like-PB 247 CG1987-PB 15..101 27..125 167 39.4 Plus
snRNP-U1-70K-PC 448 CG8749-PC 99..261 20..194 163 28.4 Plus
snRNP-U1-70K-PA 448 CG8749-PA 99..261 20..194 163 28.4 Plus
SF2-PB 255 CG6987-PB 11..116 27..136 156 38.2 Plus
SF2-PA 255 CG6987-PA 11..116 27..136 156 38.2 Plus
CG34334-PA 708 CG34334-PA 535..696 23..176 155 32.5 Plus
Rbp1-PD 144 CG17136-PD 15..115 27..139 148 35.4 Plus
atms-PB 538 CG2503-PB 395..526 74..195 147 35.6 Plus
atms-PA 538 CG2503-PA 395..526 74..195 147 35.6 Plus
caz-PD 355 CG3606-PD 57..186 4..127 146 31.1 Plus
caz-PC 384 CG3606-PC 86..215 4..127 146 31.1 Plus
caz-PB 399 CG3606-PB 101..230 4..127 146 31.1 Plus
Cbp20-PA 154 CG12357-PA 31..103 24..96 144 39.7 Plus
tra2-PE 179 CG10128-PE 16..170 27..153 141 32.9 Plus
B52-PI 135 CG10851-PI 8..116 27..140 138 35.6 Plus
B52-PD 135 CG10851-PD 8..116 27..140 138 35.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:42:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17122-PA 203 GI17122-PA 14..105 13..104 482 100 Plus
Dmoj\GI23717-PA 154 GI23717-PA 31..105 24..98 149 38.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:42:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18771-PA 72 GL18771-PA 1..68 1..68 294 92.6 Plus
Dper\GL12592-PA 154 GL12592-PA 30..105 23..98 148 38.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:42:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18884-PA 207 GA18884-PA 1..108 1..108 515 97.2 Plus
Dpse\GA11577-PA 154 GA11577-PA 30..105 23..98 148 38.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:42:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26218-PA 195 GM26218-PA 1..195 1..195 930 99.5 Plus
Dsec\GM15280-PA 154 GM15280-PA 30..105 23..98 146 38.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:42:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22120-PA 195 GD22120-PA 1..195 1..195 930 99.5 Plus
Dsim\GD19204-PA 154 GD19204-PA 30..105 23..98 146 38.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:42:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16161-PA 202 GJ16161-PA 15..105 14..104 481 100 Plus
Dvir\GJ23276-PA 154 GJ23276-PA 31..105 24..98 148 38.7 Plus
Dvir\GJ18756-PA 154 GJ18756-PA 31..103 24..96 142 38.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:42:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14626-PA 203 GK14626-PA 16..110 14..108 500 100 Plus
Dwil\GK11244-PA 154 GK11244-PA 30..103 23..96 150 39.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:42:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12283-PA 217 GE12283-PA 1..217 1..195 884 88.5 Plus
Dyak\GE25514-PA 154 GE25514-PA 30..103 23..96 148 39.2 Plus

LD32469.hyp Sequence

Translation from 64 to 651

> LD32469.hyp
MSNGGGAGGLGAARPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVG
DIYIPRDRYTRESRGFAFVRFYDKRDAEDALEAMDGRMLDGRELRVQMAR
YGRPSSPTRSSSGRRGGGGGGGSGGRRRSRSRSPMRRRSRSPRRRSYSRS
RSPGSHSPERRSKFSRSPVRGDSRNGIGSGSGGLAPAASRSRSRS*

LD32469.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:13:30
Subject Length Description Subject Range Query Range Score Percent Strand
SC35-PD 195 CG5442-PD 1..195 1..195 1009 100 Plus
SC35-PC 195 CG5442-PC 1..195 1..195 1009 100 Plus
SC35-PB 195 CG5442-PB 1..195 1..195 1009 100 Plus
SC35-PA 112 CG5442-PA 1..112 84..195 571 100 Plus
Rbp1-PA 135 CG17136-PA 15..134 27..160 222 42.5 Plus