Clone LD32555 Report

Search the DGRC for LD32555

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:325
Well:55
Vector:pOT2
Associated Gene/TranscriptIbf1-RA
Protein status:LD32555.pep: gold
Preliminary Size:1161
Sequenced Size:958

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8436 2001-01-01 Release 2 assignment
CG8436 2001-10-10 Blastp of sequenced clone
CG8436 2003-01-01 Sim4 clustering to Release 3
CG8436 2008-04-29 Release 5.5 accounting
CG8436 2008-08-15 Release 5.9 accounting
CG8436 2008-12-18 5.12 accounting

Clone Sequence Records

LD32555.complete Sequence

958 bp (958 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061399

> LD32555.complete
CCATTTTTATTTGCATCGTGTATAGTACATTGGAATTTACTGCGATTGTT
GTATTTTAAAATGCCCCGAAAGAAGTCCGAGGATTTTTACAGAACCCACG
GATTTACCGCCAATTTGGAGAATGGCAAATACTCGGCCACCTGTCACTTC
TGCGAAAAAGTACTCCAAAATACGGCGCTATCCCGGCTATCGTTACACAG
GCAAACCTGCGATGCCCGGCGAAGTAGAAGCGCTGTAGTGTACACTTCTG
CCGACGAGAAGGATCATGACGAGGCTCCTAGGATAAAGATCCAGAAGATT
TCGGGCGACGATGATGGCGGCCTGGATAATGCCAACGAAGGCAAGGAGAT
CATTGTTAAGATACAACAAATTCTGGACGATGCTGACGAGGCTGAGGCGC
CCAAGGAGCAACCCAGAGTGAAACGAGAAATTCGCAAAAGGAAACTGACC
AAAACGGAAGAGTCTGGCGAGCAAAATTTGGAATTTGAAATTTCCAACGT
TGAAATTAAAAATCCCGAATACTCTGAGTACCTGGACGAAAGCAAAGAAC
ATTACATATTGCAGCAAAACCCGGATGACTTAGCCAATGGATCGGCGACG
ATCATCGAGGCCAGGCCAAGAAATGGTTTAGCTGCATTGCGAGCGGAAAA
GGCGCGAGCCGAGATCAGTCAGTTCCAGAGTAAGACCAAGTTTCTTAAAA
CGGAAACGGACAATCTAAAAGTAGAGCGCACACTGACTTTGCTTAAGATT
CAGAAGCTTCGATTGGAAATCGACGCCCTACGCGATTAAAATGTATTTTA
ACTATAGATAACTTTTAAATGTCCGCATGGTGAACCCTTAATTTTTGTTA
AGATGACGAAAATGTCTGTCTTGAATTCAACATAGATTTATTACATTTAA
CTTTGTAAAGGTGATTACAAAATACATTATTTTAAGCCTAAAAAAAAAAA
AAAAAAAA

LD32555.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:04:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG8436-RA 1103 CG8436-RA 56..994 1..939 4695 100 Plus
CG8436.a 1088 CG8436.a 56..606 1..551 2755 100 Plus
CG8436.a 1088 CG8436.a 605..979 565..939 1875 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:12:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 5085788..5086177 550..939 1950 100 Plus
chr3R 27901430 chr3R 5084765..5084965 1..201 1005 100 Plus
chr3R 27901430 chr3R 5085543..5085733 359..549 955 100 Plus
chr3R 27901430 chr3R 5085029..5085118 199..288 450 100 Plus
chr3R 27901430 chr3R 5085407..5085480 287..360 370 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:26:34 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:12:06
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9260011..9260400 550..939 1950 100 Plus
3R 32079331 3R 9258988..9259188 1..201 1005 100 Plus
3R 32079331 3R 9259766..9259956 359..549 955 100 Plus
3R 32079331 3R 9259252..9259341 199..288 450 100 Plus
3R 32079331 3R 9259630..9259703 287..360 370 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:29:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 9000842..9001231 550..939 1950 100 Plus
3R 31820162 3R 8999819..9000019 1..201 1005 100 Plus
3R 31820162 3R 9000597..9000787 359..549 955 100 Plus
3R 31820162 3R 9000083..9000172 199..288 450 100 Plus
3R 31820162 3R 9000461..9000534 287..360 370 100 Plus
Blast to na_te.dros performed 2019-03-16 01:12:06
Subject Length Description Subject Range Query Range Score Percent Strand
HeT-A 6083 HeT-A DM06920 6083bp Derived from U06920.2 (Rel. 67, Last updated, Version 14). 5800..5847 928..881 114 70.8 Minus

LD32555.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:13:06 Download gff for LD32555.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 5084765..5084964 1..200 100 -> Plus
chr3R 5085031..5085118 201..288 100 -> Plus
chr3R 5085409..5085480 289..360 100 -> Plus
chr3R 5085545..5085733 361..549 100 -> Plus
chr3R 5085788..5086177 550..939 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:14:07 Download gff for LD32555.complete
Subject Subject Range Query Range Percent Splice Strand
CG8436-RA 1..729 61..789 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:39:56 Download gff for LD32555.complete
Subject Subject Range Query Range Percent Splice Strand
CG8436-RA 1..729 61..789 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:03:29 Download gff for LD32555.complete
Subject Subject Range Query Range Percent Splice Strand
CG8436-RA 1..729 61..789 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:08:45 Download gff for LD32555.complete
Subject Subject Range Query Range Percent Splice Strand
CG8436-RA 1..729 61..789 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:26:31 Download gff for LD32555.complete
Subject Subject Range Query Range Percent Splice Strand
Ibf1-RA 1..729 61..789 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:21:27 Download gff for LD32555.complete
Subject Subject Range Query Range Percent Splice Strand
CG8436-RA 20..958 1..939 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:39:56 Download gff for LD32555.complete
Subject Subject Range Query Range Percent Splice Strand
CG8436-RA 20..958 1..939 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:03:29 Download gff for LD32555.complete
Subject Subject Range Query Range Percent Splice Strand
CG8436-RA 25..963 1..939 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:08:45 Download gff for LD32555.complete
Subject Subject Range Query Range Percent Splice Strand
CG8436-RA 20..958 1..939 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:26:31 Download gff for LD32555.complete
Subject Subject Range Query Range Percent Splice Strand
Ibf1-RA 25..963 1..939 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:13:06 Download gff for LD32555.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9258988..9259187 1..200 100 -> Plus
3R 9259254..9259341 201..288 100 -> Plus
3R 9259632..9259703 289..360 100 -> Plus
3R 9259768..9259956 361..549 100 -> Plus
3R 9260011..9260400 550..939 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:13:06 Download gff for LD32555.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9258988..9259187 1..200 100 -> Plus
3R 9259254..9259341 201..288 100 -> Plus
3R 9259632..9259703 289..360 100 -> Plus
3R 9259768..9259956 361..549 100 -> Plus
3R 9260011..9260400 550..939 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:13:06 Download gff for LD32555.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9258988..9259187 1..200 100 -> Plus
3R 9259254..9259341 201..288 100 -> Plus
3R 9259632..9259703 289..360 100 -> Plus
3R 9259768..9259956 361..549 100 -> Plus
3R 9260011..9260400 550..939 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:03:29 Download gff for LD32555.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5084710..5084909 1..200 100 -> Plus
arm_3R 5084976..5085063 201..288 100 -> Plus
arm_3R 5085354..5085425 289..360 100 -> Plus
arm_3R 5085490..5085678 361..549 100 -> Plus
arm_3R 5085733..5086122 550..939 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:44:59 Download gff for LD32555.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9000842..9001231 550..939 100   Plus
3R 8999819..9000018 1..200 100 -> Plus
3R 9000085..9000172 201..288 100 -> Plus
3R 9000463..9000534 289..360 100 -> Plus
3R 9000599..9000787 361..549 100 -> Plus

LD32555.hyp Sequence

Translation from 0 to 788

> LD32555.hyp
PFLFASCIVHWNLLRLLYFKMPRKKSEDFYRTHGFTANLENGKYSATCHF
CEKVLQNTALSRLSLHRQTCDARRSRSAVVYTSADEKDHDEAPRIKIQKI
SGDDDGGLDNANEGKEIIVKIQQILDDADEAEAPKEQPRVKREIRKRKLT
KTEESGEQNLEFEISNVEIKNPEYSEYLDESKEHYILQQNPDDLANGSAT
IIEARPRNGLAALRAEKARAEISQFQSKTKFLKTETDNLKVERTLTLLKI
QKLRLEIDALRD*

LD32555.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:28:48
Subject Length Description Subject Range Query Range Score Percent Strand
Ibf1-PA 242 CG8436-PA 1..242 21..262 1228 100 Plus
Ibf1-PB 237 CG8436-PB 1..237 21..262 1184 97.9 Plus

LD32555.pep Sequence

Translation from 60 to 788

> LD32555.pep
MPRKKSEDFYRTHGFTANLENGKYSATCHFCEKVLQNTALSRLSLHRQTC
DARRSRSAVVYTSADEKDHDEAPRIKIQKISGDDDGGLDNANEGKEIIVK
IQQILDDADEAEAPKEQPRVKREIRKRKLTKTEESGEQNLEFEISNVEIK
NPEYSEYLDESKEHYILQQNPDDLANGSATIIEARPRNGLAALRAEKARA
EISQFQSKTKFLKTETDNLKVERTLTLLKIQKLRLEIDALRD*

LD32555.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:37:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16586-PA 244 GF16586-PA 1..241 1..241 746 65.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:37:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15863-PA 242 GG15863-PA 1..242 1..242 1201 94.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:16
Subject Length Description Subject Range Query Range Score Percent Strand
Ibf1-PA 242 CG8436-PA 1..242 1..242 1228 100 Plus
Ibf1-PB 237 CG8436-PB 1..237 1..242 1184 97.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:37:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13946-PA 240 GL13946-PA 1..237 1..241 588 54.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:37:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21077-PA 240 GA21077-PA 1..237 1..241 588 55 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:37:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23790-PA 242 GM23790-PA 1..242 1..242 1262 98.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:37:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18601-PA 242 GD18601-PA 1..242 1..242 1254 98.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:37:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22432-PA 135 GK22432-PA 72..132 182..241 219 73.8 Plus
Dwil\GK22432-PA 135 GK22432-PA 1..55 1..55 190 61.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:37:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25937-PA 242 GE25937-PA 1..242 1..242 1203 93 Plus