Associations are from manual ordering of a clone or by a periodic analysis.
Clone Sequence Records
LD32555.complete Sequence
958 bp (958 high quality bases) assembled on 2001-10-10
GenBank Submission: AY061399
> LD32555.complete
CCATTTTTATTTGCATCGTGTATAGTACATTGGAATTTACTGCGATTGTT
GTATTTTAAAATGCCCCGAAAGAAGTCCGAGGATTTTTACAGAACCCACG
GATTTACCGCCAATTTGGAGAATGGCAAATACTCGGCCACCTGTCACTTC
TGCGAAAAAGTACTCCAAAATACGGCGCTATCCCGGCTATCGTTACACAG
GCAAACCTGCGATGCCCGGCGAAGTAGAAGCGCTGTAGTGTACACTTCTG
CCGACGAGAAGGATCATGACGAGGCTCCTAGGATAAAGATCCAGAAGATT
TCGGGCGACGATGATGGCGGCCTGGATAATGCCAACGAAGGCAAGGAGAT
CATTGTTAAGATACAACAAATTCTGGACGATGCTGACGAGGCTGAGGCGC
CCAAGGAGCAACCCAGAGTGAAACGAGAAATTCGCAAAAGGAAACTGACC
AAAACGGAAGAGTCTGGCGAGCAAAATTTGGAATTTGAAATTTCCAACGT
TGAAATTAAAAATCCCGAATACTCTGAGTACCTGGACGAAAGCAAAGAAC
ATTACATATTGCAGCAAAACCCGGATGACTTAGCCAATGGATCGGCGACG
ATCATCGAGGCCAGGCCAAGAAATGGTTTAGCTGCATTGCGAGCGGAAAA
GGCGCGAGCCGAGATCAGTCAGTTCCAGAGTAAGACCAAGTTTCTTAAAA
CGGAAACGGACAATCTAAAAGTAGAGCGCACACTGACTTTGCTTAAGATT
CAGAAGCTTCGATTGGAAATCGACGCCCTACGCGATTAAAATGTATTTTA
ACTATAGATAACTTTTAAATGTCCGCATGGTGAACCCTTAATTTTTGTTA
AGATGACGAAAATGTCTGTCTTGAATTCAACATAGATTTATTACATTTAA
CTTTGTAAAGGTGATTACAAAATACATTATTTTAAGCCTAAAAAAAAAAA
AAAAAAAA
LD32555.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 20:04:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG8436-RA | 1103 | CG8436-RA | 56..994 | 1..939 | 4695 | 100 | Plus |
CG8436.a | 1088 | CG8436.a | 56..606 | 1..551 | 2755 | 100 | Plus |
CG8436.a | 1088 | CG8436.a | 605..979 | 565..939 | 1875 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:12:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 5085788..5086177 | 550..939 | 1950 | 100 | Plus |
chr3R | 27901430 | chr3R | 5084765..5084965 | 1..201 | 1005 | 100 | Plus |
chr3R | 27901430 | chr3R | 5085543..5085733 | 359..549 | 955 | 100 | Plus |
chr3R | 27901430 | chr3R | 5085029..5085118 | 199..288 | 450 | 100 | Plus |
chr3R | 27901430 | chr3R | 5085407..5085480 | 287..360 | 370 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:26:34 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:12:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 9260011..9260400 | 550..939 | 1950 | 100 | Plus |
3R | 32079331 | 3R | 9258988..9259188 | 1..201 | 1005 | 100 | Plus |
3R | 32079331 | 3R | 9259766..9259956 | 359..549 | 955 | 100 | Plus |
3R | 32079331 | 3R | 9259252..9259341 | 199..288 | 450 | 100 | Plus |
3R | 32079331 | 3R | 9259630..9259703 | 287..360 | 370 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:29:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 9000842..9001231 | 550..939 | 1950 | 100 | Plus |
3R | 31820162 | 3R | 8999819..9000019 | 1..201 | 1005 | 100 | Plus |
3R | 31820162 | 3R | 9000597..9000787 | 359..549 | 955 | 100 | Plus |
3R | 31820162 | 3R | 9000083..9000172 | 199..288 | 450 | 100 | Plus |
3R | 31820162 | 3R | 9000461..9000534 | 287..360 | 370 | 100 | Plus |
Blast to na_te.dros performed 2019-03-16 01:12:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
HeT-A | 6083 | HeT-A DM06920 6083bp Derived from U06920.2 (Rel. 67, Last updated, Version 14). | 5800..5847 | 928..881 | 114 | 70.8 | Minus |
LD32555.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:13:06 Download gff for
LD32555.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 5084765..5084964 | 1..200 | 100 | -> | Plus |
chr3R | 5085031..5085118 | 201..288 | 100 | -> | Plus |
chr3R | 5085409..5085480 | 289..360 | 100 | -> | Plus |
chr3R | 5085545..5085733 | 361..549 | 100 | -> | Plus |
chr3R | 5085788..5086177 | 550..939 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:14:07 Download gff for
LD32555.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8436-RA | 1..729 | 61..789 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:39:56 Download gff for
LD32555.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8436-RA | 1..729 | 61..789 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:03:29 Download gff for
LD32555.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8436-RA | 1..729 | 61..789 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:08:45 Download gff for
LD32555.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8436-RA | 1..729 | 61..789 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:26:31 Download gff for
LD32555.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ibf1-RA | 1..729 | 61..789 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:21:27 Download gff for
LD32555.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8436-RA | 20..958 | 1..939 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:39:56 Download gff for
LD32555.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8436-RA | 20..958 | 1..939 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:03:29 Download gff for
LD32555.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8436-RA | 25..963 | 1..939 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:08:45 Download gff for
LD32555.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8436-RA | 20..958 | 1..939 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:26:31 Download gff for
LD32555.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ibf1-RA | 25..963 | 1..939 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:13:06 Download gff for
LD32555.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 9258988..9259187 | 1..200 | 100 | -> | Plus |
3R | 9259254..9259341 | 201..288 | 100 | -> | Plus |
3R | 9259632..9259703 | 289..360 | 100 | -> | Plus |
3R | 9259768..9259956 | 361..549 | 100 | -> | Plus |
3R | 9260011..9260400 | 550..939 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:13:06 Download gff for
LD32555.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 9258988..9259187 | 1..200 | 100 | -> | Plus |
3R | 9259254..9259341 | 201..288 | 100 | -> | Plus |
3R | 9259632..9259703 | 289..360 | 100 | -> | Plus |
3R | 9259768..9259956 | 361..549 | 100 | -> | Plus |
3R | 9260011..9260400 | 550..939 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:13:06 Download gff for
LD32555.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 9258988..9259187 | 1..200 | 100 | -> | Plus |
3R | 9259254..9259341 | 201..288 | 100 | -> | Plus |
3R | 9259632..9259703 | 289..360 | 100 | -> | Plus |
3R | 9259768..9259956 | 361..549 | 100 | -> | Plus |
3R | 9260011..9260400 | 550..939 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:03:29 Download gff for
LD32555.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 5084710..5084909 | 1..200 | 100 | -> | Plus |
arm_3R | 5084976..5085063 | 201..288 | 100 | -> | Plus |
arm_3R | 5085354..5085425 | 289..360 | 100 | -> | Plus |
arm_3R | 5085490..5085678 | 361..549 | 100 | -> | Plus |
arm_3R | 5085733..5086122 | 550..939 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:44:59 Download gff for
LD32555.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 9000842..9001231 | 550..939 | 100 | | Plus |
3R | 8999819..9000018 | 1..200 | 100 | -> | Plus |
3R | 9000085..9000172 | 201..288 | 100 | -> | Plus |
3R | 9000463..9000534 | 289..360 | 100 | -> | Plus |
3R | 9000599..9000787 | 361..549 | 100 | -> | Plus |
LD32555.hyp Sequence
Translation from 0 to 788
> LD32555.hyp
PFLFASCIVHWNLLRLLYFKMPRKKSEDFYRTHGFTANLENGKYSATCHF
CEKVLQNTALSRLSLHRQTCDARRSRSAVVYTSADEKDHDEAPRIKIQKI
SGDDDGGLDNANEGKEIIVKIQQILDDADEAEAPKEQPRVKREIRKRKLT
KTEESGEQNLEFEISNVEIKNPEYSEYLDESKEHYILQQNPDDLANGSAT
IIEARPRNGLAALRAEKARAEISQFQSKTKFLKTETDNLKVERTLTLLKI
QKLRLEIDALRD*
LD32555.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:28:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Ibf1-PA | 242 | CG8436-PA | 1..242 | 21..262 | 1228 | 100 | Plus |
Ibf1-PB | 237 | CG8436-PB | 1..237 | 21..262 | 1184 | 97.9 | Plus |
LD32555.pep Sequence
Translation from 60 to 788
> LD32555.pep
MPRKKSEDFYRTHGFTANLENGKYSATCHFCEKVLQNTALSRLSLHRQTC
DARRSRSAVVYTSADEKDHDEAPRIKIQKISGDDDGGLDNANEGKEIIVK
IQQILDDADEAEAPKEQPRVKREIRKRKLTKTEESGEQNLEFEISNVEIK
NPEYSEYLDESKEHYILQQNPDDLANGSATIIEARPRNGLAALRAEKARA
EISQFQSKTKFLKTETDNLKVERTLTLLKIQKLRLEIDALRD*
LD32555.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:37:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF16586-PA | 244 | GF16586-PA | 1..241 | 1..241 | 746 | 65.4 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:37:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG15863-PA | 242 | GG15863-PA | 1..242 | 1..242 | 1201 | 94.2 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Ibf1-PA | 242 | CG8436-PA | 1..242 | 1..242 | 1228 | 100 | Plus |
Ibf1-PB | 237 | CG8436-PB | 1..237 | 1..242 | 1184 | 97.9 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:37:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL13946-PA | 240 | GL13946-PA | 1..237 | 1..241 | 588 | 54.6 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:37:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA21077-PA | 240 | GA21077-PA | 1..237 | 1..241 | 588 | 55 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:37:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM23790-PA | 242 | GM23790-PA | 1..242 | 1..242 | 1262 | 98.8 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:37:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD18601-PA | 242 | GD18601-PA | 1..242 | 1..242 | 1254 | 98.3 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:37:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK22432-PA | 135 | GK22432-PA | 72..132 | 182..241 | 219 | 73.8 | Plus |
Dwil\GK22432-PA | 135 | GK22432-PA | 1..55 | 1..55 | 190 | 61.8 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:37:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE25937-PA | 242 | GE25937-PA | 1..242 | 1..242 | 1203 | 93 | Plus |