LD32961.complete Sequence
1966 bp assembled on 2009-09-30
GenBank Submission: BT099919.1
> LD32961.complete
GTCATTGTTATTTTTTCTAATGCAATGTAATGCAGCAAATGTGCAGATTT
GAACAAGTGTAACGCGATTTATGTTTAATCCGCATCGAGGAACCAAATCG
AAGTAAACGCGCGGCCAGAGAAAAGAGCAGCACCGCACCGAAGATAAAAC
AAACAAGCATTGATTTGTTTGTCCGGCCATGTCAGTGTGTGTGTCACAAG
GGCTTGCAAGTGTGTGCGTGTGTCCGTGCGTGTACGTGGGTGCTTTTTTT
TTTCTCCCGAGTGCCGCCAAGTGAAATATGCAATTGCACGCCACTGCAGT
TGCAGCCACACAAATCCTATCCTAATCGACGAAACAGCGAAGCGAGGAGG
CTAGAATCGGCTGCCCAACGAAGAGAGCAGAACCGTTAACAAATGACACT
CTGCCGATACAGCGAAGTAAAAATCAATAATTAGAGCAAAAAGAGTCATG
TTAAACAGCGCTAATAACAATTCTCCCCAGCACCCGGTGAGTGCACCATC
CGATATCAACATGAATGGCTATAACCGAAAATTGCCACAAAAACGTGGCT
ATGAGATGCCAAAATACTCTGATCCAAAAAAGAAAATGTGCAAGGAGCGC
ATTCCCCAGCCGAAGAACACGGTGGCCATGCTGAATGAGCTAAGACATGG
ACTGATTTACAAATTGGAGTCACAGACTGGTCCGGTACACGCACCTCTAT
TCACGATATCCGTGGAGGTCGATGGACAGAAATACTTGGGCCAGGGCCGT
AGTAAAAAAGTTGCACGCATCGAAGCAGCAGCAACTGCACTGCGCAGCTT
TATACAGTTTAAGGATGGAGCAGTTCTGTCGCCTCTGAAGCCGGCGGGCA
ACTTGGACTTTACCAGCGATGAACATCTTGAAAATGGTATTGAAAATTTG
TCCAGTTCAAAAATGTTTGAGATCATTCAGACGATGTTGACTGAAAAGCT
ATCCAACCCTACCTCGCTTGAACAACCCACGTTTTGCATGAGTCAGAATG
TCAGCAAAAGTGCTATTACTGTTGACGGTCAGAAGAAGGTTCCAGATAAG
GGTCCTGTCATGCTCCTCTACGAATTATTTAATGACGTTAATTTCGAATG
CATTAATATTGACGGCGCCCAGAACAATTGTCGCTTCAAAATGACCGTCA
CAATCAACGAAAAGAAGTTCGATGGAACAGGTCCTTCCAAAAAGACGGCG
AAAAATGCGGCAGCTAAGGCGGCACTTGCTTCGTTATGCAATATTTCCTA
CAGTCCAATGGTGGTGCCACAGAAGAACGTACCCCTGCCAATCGACGACA
AGTCGTCATCGATGGAGTTGCCTCAGATACACGCGGATACGATTGGTCGG
TTGGTCTTAGAAAAGTTCATGGAAGTAATCAAGGGCCAGGAGGCTTACTC
GCGTCGAAAGGTATTAGCGGGCATTGTAATGACTGAAAACATGAATTTTT
GTGAAGCCAAAGTTATTTCAGTTTCGACGGGCACCAAGTGTGTCAGCGGT
GAGCATATGAGTGTGAACGGAGCTGTCCTAAATGATTCCCATGCTGAAAT
AGTCTCCAGGCGTTGTCTTCTCAAATATTTATATGCACAGCTGGACCTTC
AGTGCAATCAGGGTATAGTTGTTTGATGTATATGCTAAGTTCAGTTTACG
TATACTAATAATACCATAGAACTTAAATCTAAGAGTAATGCATAATCTAG
TTGTTAAATGTTGATATCGAAAATGTACGCTTTACCAGCAAGAATTGCCT
ACATAGAAGCTAAAGTTCCGATTTGTGCTCATTAACCGTATACGAGCACA
AACTTTTATTTTTTCTTTCTTTTACACATTATAAACAAGCACTTTAAGCT
AACTTATGTTTTCCCCGTCTGATCGTTTTAGAAGGTGTTTATACAAAATT
AAATTTTAAGGGCAAACCATCTTAAAAATAAACAATTTGTAAACATTAAA
AAAAAAAAAAAAAAAA
LD32961.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 16:50:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Adar.c | 2066 | Adar.c | 60..2007 | 1..1948 | 9740 | 100 | Plus |
Adar-RC | 3523 | Adar-RC | 60..1056 | 1..997 | 4985 | 100 | Plus |
Adar.k | 6820 | Adar.k | 161..1046 | 1..886 | 4430 | 100 | Plus |
Adar-RC | 3523 | Adar-RC | 1749..2363 | 998..1612 | 3075 | 100 | Plus |
Adar.k | 6820 | Adar.k | 1047..1661 | 998..1612 | 3075 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:00:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chrX | 22417052 | chrX | 1674533..1675018 | 1462..1947 | 2415 | 99.8 | Plus |
chrX | 22417052 | chrX | 1667640..1668082 | 1..443 | 2215 | 100 | Plus |
chrX | 22417052 | chrX | 1674187..1674471 | 1179..1463 | 1425 | 100 | Plus |
chrX | 22417052 | chrX | 1672946..1673227 | 716..997 | 1410 | 100 | Plus |
chrX | 22417052 | chrX | 1673920..1674104 | 998..1182 | 925 | 100 | Plus |
chrX | 22417052 | chrX | 1672672..1672820 | 571..719 | 745 | 100 | Plus |
chrX | 22417052 | chrX | 1672470..1672557 | 484..571 | 440 | 100 | Plus |
chrX | 22417052 | chrX | 1669555..1669596 | 442..483 | 210 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:27:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:00:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 1780675..1781161 | 1462..1948 | 2435 | 100 | Plus |
X | 23542271 | X | 1773780..1774222 | 1..443 | 2215 | 100 | Plus |
X | 23542271 | X | 1780329..1780613 | 1179..1463 | 1425 | 100 | Plus |
X | 23542271 | X | 1779088..1779369 | 716..997 | 1410 | 100 | Plus |
X | 23542271 | X | 1780062..1780246 | 998..1182 | 925 | 100 | Plus |
X | 23542271 | X | 1778814..1778962 | 571..719 | 745 | 100 | Plus |
X | 23542271 | X | 1778612..1778699 | 484..571 | 440 | 100 | Plus |
X | 23542271 | X | 1775697..1775738 | 442..483 | 210 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:47:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23527363 | X | 1788773..1789259 | 1462..1948 | 2435 | 100 | Plus |
X | 23527363 | X | 1781878..1782320 | 1..443 | 2215 | 100 | Plus |
X | 23527363 | X | 1788427..1788711 | 1179..1463 | 1425 | 100 | Plus |
X | 23527363 | X | 1787186..1787467 | 716..997 | 1410 | 100 | Plus |
X | 23527363 | X | 1788160..1788344 | 998..1182 | 925 | 100 | Plus |
X | 23527363 | X | 1786912..1787060 | 571..719 | 745 | 100 | Plus |
X | 23527363 | X | 1786710..1786797 | 484..571 | 440 | 100 | Plus |
X | 23527363 | X | 1783795..1783836 | 442..483 | 210 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-15 21:00:15 has no hits.
LD32961.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:01:30 Download gff for
LD32961.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chrX | 1669557..1669596 | 444..483 | 100 | -> | Plus |
chrX | 1672470..1672557 | 484..571 | 100 | -> | Plus |
chrX | 1672673..1672818 | 572..717 | 100 | -> | Plus |
chrX | 1667640..1668082 | 1..443 | 100 | -> | Plus |
chrX | 1672948..1673227 | 718..997 | 100 | -> | Plus |
chrX | 1673920..1674102 | 998..1180 | 100 | -> | Plus |
chrX | 1674189..1674469 | 1181..1461 | 100 | -> | Plus |
chrX | 1674533..1675018 | 1462..1947 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:56:15 Download gff for
LD32961.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Adar-RB | 18..427 | 478..886 | 99 | == | Plus |
Adar-RB | 428..1048 | 998..1618 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:36:15 Download gff for
LD32961.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Adar-RB | 18..427 | 478..886 | 99 | == | Plus |
Adar-RB | 428..1048 | 998..1618 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:33:24 Download gff for
LD32961.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Adar-RK | 1..1179 | 448..1626 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:39:33 Download gff for
LD32961.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Adar-RK | 1..1179 | 448..1626 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-30 10:16:37 Download gff for
LD32961.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Adar-RC | 31..1027 | 1..997 | 100 | -> | Plus |
Adar-RC | 1720..2340 | 998..1618 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:36:15 Download gff for
LD32961.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Adar-RC | 31..1027 | 1..997 | 100 | -> | Plus |
Adar-RC | 1720..2340 | 998..1618 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:33:24 Download gff for
LD32961.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Adar-RD | 56..2002 | 1..1947 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:39:33 Download gff for
LD32961.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Adar-RD | 56..2002 | 1..1947 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:01:30 Download gff for
LD32961.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 1773780..1774222 | 1..443 | 100 | -> | Plus |
X | 1775699..1775738 | 444..483 | 100 | -> | Plus |
X | 1778612..1778699 | 484..571 | 100 | -> | Plus |
X | 1778815..1778960 | 572..717 | 100 | -> | Plus |
X | 1779090..1779369 | 718..997 | 100 | -> | Plus |
X | 1780062..1780244 | 998..1180 | 100 | -> | Plus |
X | 1780331..1780611 | 1181..1461 | 100 | -> | Plus |
X | 1780675..1781160 | 1462..1947 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:01:30 Download gff for
LD32961.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 1773780..1774222 | 1..443 | 100 | -> | Plus |
X | 1775699..1775738 | 444..483 | 100 | -> | Plus |
X | 1778612..1778699 | 484..571 | 100 | -> | Plus |
X | 1778815..1778960 | 572..717 | 100 | -> | Plus |
X | 1779090..1779369 | 718..997 | 100 | -> | Plus |
X | 1780062..1780244 | 998..1180 | 100 | -> | Plus |
X | 1780331..1780611 | 1181..1461 | 100 | -> | Plus |
X | 1780675..1781160 | 1462..1947 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:01:30 Download gff for
LD32961.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 1773780..1774222 | 1..443 | 100 | -> | Plus |
X | 1775699..1775738 | 444..483 | 100 | -> | Plus |
X | 1778612..1778699 | 484..571 | 100 | -> | Plus |
X | 1778815..1778960 | 572..717 | 100 | -> | Plus |
X | 1779090..1779369 | 718..997 | 100 | -> | Plus |
X | 1780062..1780244 | 998..1180 | 100 | -> | Plus |
X | 1780331..1780611 | 1181..1461 | 100 | -> | Plus |
X | 1780675..1781160 | 1462..1947 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:33:24 Download gff for
LD32961.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 1672645..1672732 | 484..571 | 100 | -> | Plus |
arm_X | 1672848..1672993 | 572..717 | 100 | -> | Plus |
arm_X | 1674095..1674277 | 998..1180 | 100 | -> | Plus |
arm_X | 1673123..1673402 | 718..997 | 100 | -> | Plus |
arm_X | 1667813..1668255 | 1..443 | 100 | -> | Plus |
arm_X | 1669732..1669771 | 444..483 | 100 | -> | Plus |
arm_X | 1674364..1674644 | 1181..1461 | 100 | -> | Plus |
arm_X | 1674708..1675193 | 1462..1947 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:19:36 Download gff for
LD32961.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 1781878..1782320 | 1..443 | 100 | -> | Plus |
X | 1783797..1783836 | 444..483 | 100 | -> | Plus |
X | 1786710..1786797 | 484..571 | 100 | -> | Plus |
X | 1786913..1787058 | 572..717 | 100 | -> | Plus |
X | 1787188..1787467 | 718..997 | 100 | -> | Plus |
X | 1788160..1788342 | 998..1180 | 100 | -> | Plus |
X | 1788429..1788709 | 1181..1461 | 100 | -> | Plus |
X | 1788773..1789258 | 1462..1947 | 100 | | Plus |
LD32961.pep Sequence
Translation from 447 to 1625
> LD32961.pep
MLNSANNNSPQHPVSAPSDINMNGYNRKLPQKRGYEMPKYSDPKKKMCKE
RIPQPKNTVAMLNELRHGLIYKLESQTGPVHAPLFTISVEVDGQKYLGQG
RSKKVARIEAAATALRSFIQFKDGAVLSPLKPAGNLDFTSDEHLENGIEN
LSSSKMFEIIQTMLTEKLSNPTSLEQPTFCMSQNVSKSAITVDGQKKVPD
KGPVMLLYELFNDVNFECINIDGAQNNCRFKMTVTINEKKFDGTGPSKKT
AKNAAAKAALASLCNISYSPMVVPQKNVPLPIDDKSSSMELPQIHADTIG
RLVLEKFMEVIKGQEAYSRRKVLAGIVMTENMNFCEAKVISVSTGTKCVS
GEHMSVNGAVLNDSHAEIVSRRCLLKYLYAQLDLQCNQGIVV*
LD32961.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:59:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF22002-PA | 556 | GF22002-PA | 15..275 | 91..388 | 1329 | 86.2 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:59:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG12877-PA | 632 | GG12877-PA | 1..352 | 1..389 | 1805 | 88.7 | Plus |
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:59:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dgri\GH24441-PA | 633 | GH24441-PA | 1..352 | 1..388 | 1599 | 82.3 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Adar-PD | 392 | CG12598-PD | 1..392 | 1..392 | 2016 | 100 | Plus |
Adar-PK | 392 | CG12598-PK | 1..392 | 1..392 | 2016 | 100 | Plus |
Adar-PN | 669 | CG12598-PN | 1..388 | 1..388 | 1998 | 100 | Plus |
Adar-PJ | 389 | CG12598-PJ | 8..389 | 11..392 | 1961 | 99.7 | Plus |
Adar-PH | 665 | CG12598-PH | 9..384 | 13..388 | 1933 | 100 | Plus |
Adar-PO | 355 | CG12598-PO | 1..355 | 1..392 | 1778 | 90.3 | Plus |
Adar-PI | 632 | CG12598-PI | 1..351 | 1..388 | 1760 | 90.2 | Plus |
Adar-PA | 632 | CG12598-PA | 1..351 | 1..388 | 1760 | 90.2 | Plus |
Adar-PE | 634 | CG12598-PE | 15..353 | 13..388 | 1695 | 89.9 | Plus |
Adar-PB | 628 | CG12598-PB | 9..347 | 13..388 | 1695 | 89.9 | Plus |
Adar-PP | 334 | CG12598-PP | 1..334 | 22..392 | 1667 | 89.8 | Plus |
Adar-PF | 611 | CG12598-PF | 1..330 | 22..388 | 1649 | 89.6 | Plus |
Adar-PC | 186 | CG12598-PC | 1..184 | 1..184 | 948 | 99.5 | Plus |
Adar-PM | 188 | CG12598-PM | 15..186 | 13..184 | 883 | 99.4 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:59:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI16028-PA | 633 | GI16028-PA | 1..352 | 1..388 | 1602 | 82.8 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:59:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL14352-PA | 619 | GL14352-PA | 1..339 | 1..389 | 1596 | 80.5 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:59:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA11711-PA | 633 | GA11711-PA | 1..353 | 1..389 | 1615 | 83.8 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:59:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM19166-PA | 602 | GM19166-PA | 9..348 | 13..389 | 1653 | 87.3 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:59:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ18414-PA | 633 | GJ18414-PA | 1..352 | 1..388 | 1598 | 82.5 | Plus |
Dvir\GJ18090-PA | 417 | GJ18090-PA | 14..97 | 299..382 | 161 | 40 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:59:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK25300-PA | 720 | GK25300-PA | 109..440 | 22..389 | 1503 | 81.6 | Plus |
Dwil\GK16285-PA | 403 | GK16285-PA | 6..92 | 297..383 | 155 | 39.8 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:59:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE16707-PA | 632 | GE16707-PA | 1..352 | 1..389 | 1805 | 88.7 | Plus |
LD32961.hyp Sequence
Translation from 447 to 1625
> LD32961.hyp
MLNSANNNSPQHPVSAPSDINMNGYNRKLPQKRGYEMPKYSDPKKKMCKE
RIPQPKNTVAMLNELRHGLIYKLESQTGPVHAPLFTISVEVDGQKYLGQG
RSKKVARIEAAATALRSFIQFKDGAVLSPLKPAGNLDFTSDEHLENGIEN
LSSSKMFEIIQTMLTEKLSNPTSLEQPTFCMSQNVSKSAITVDGQKKVPD
KGPVMLLYELFNDVNFECINIDGAQNNCRFKMTVTINEKKFDGTGPSKKT
AKNAAAKAALASLCNISYSPMVVPQKNVPLPIDDKSSSMELPQIHADTIG
RLVLEKFMEVIKGQEAYSRRKVLAGIVMTENMNFCEAKVISVSTGTKCVS
GEHMSVNGAVLNDSHAEIVSRRCLLKYLYAQLDLQCNQGIVV*
LD32961.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:15:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Adar-PD | 392 | CG12598-PD | 1..392 | 1..392 | 2016 | 100 | Plus |
Adar-PK | 392 | CG12598-PK | 1..392 | 1..392 | 2016 | 100 | Plus |
Adar-PN | 669 | CG12598-PN | 1..388 | 1..388 | 1998 | 100 | Plus |
Adar-PJ | 389 | CG12598-PJ | 8..389 | 11..392 | 1961 | 99.7 | Plus |
Adar-PH | 665 | CG12598-PH | 9..384 | 13..388 | 1933 | 100 | Plus |