Clone LD32961 Report

Search the DGRC for LD32961

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:329
Well:61
Vector:pOT2
Associated Gene/TranscriptAdar-RD
Protein status:LD32961.pep: gold
Sequenced Size:1966

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Adar 2009-03-27 Manual selection by Ken Wan

Clone Sequence Records

LD32961.complete Sequence

1966 bp assembled on 2009-09-30

GenBank Submission: BT099919.1

> LD32961.complete
GTCATTGTTATTTTTTCTAATGCAATGTAATGCAGCAAATGTGCAGATTT
GAACAAGTGTAACGCGATTTATGTTTAATCCGCATCGAGGAACCAAATCG
AAGTAAACGCGCGGCCAGAGAAAAGAGCAGCACCGCACCGAAGATAAAAC
AAACAAGCATTGATTTGTTTGTCCGGCCATGTCAGTGTGTGTGTCACAAG
GGCTTGCAAGTGTGTGCGTGTGTCCGTGCGTGTACGTGGGTGCTTTTTTT
TTTCTCCCGAGTGCCGCCAAGTGAAATATGCAATTGCACGCCACTGCAGT
TGCAGCCACACAAATCCTATCCTAATCGACGAAACAGCGAAGCGAGGAGG
CTAGAATCGGCTGCCCAACGAAGAGAGCAGAACCGTTAACAAATGACACT
CTGCCGATACAGCGAAGTAAAAATCAATAATTAGAGCAAAAAGAGTCATG
TTAAACAGCGCTAATAACAATTCTCCCCAGCACCCGGTGAGTGCACCATC
CGATATCAACATGAATGGCTATAACCGAAAATTGCCACAAAAACGTGGCT
ATGAGATGCCAAAATACTCTGATCCAAAAAAGAAAATGTGCAAGGAGCGC
ATTCCCCAGCCGAAGAACACGGTGGCCATGCTGAATGAGCTAAGACATGG
ACTGATTTACAAATTGGAGTCACAGACTGGTCCGGTACACGCACCTCTAT
TCACGATATCCGTGGAGGTCGATGGACAGAAATACTTGGGCCAGGGCCGT
AGTAAAAAAGTTGCACGCATCGAAGCAGCAGCAACTGCACTGCGCAGCTT
TATACAGTTTAAGGATGGAGCAGTTCTGTCGCCTCTGAAGCCGGCGGGCA
ACTTGGACTTTACCAGCGATGAACATCTTGAAAATGGTATTGAAAATTTG
TCCAGTTCAAAAATGTTTGAGATCATTCAGACGATGTTGACTGAAAAGCT
ATCCAACCCTACCTCGCTTGAACAACCCACGTTTTGCATGAGTCAGAATG
TCAGCAAAAGTGCTATTACTGTTGACGGTCAGAAGAAGGTTCCAGATAAG
GGTCCTGTCATGCTCCTCTACGAATTATTTAATGACGTTAATTTCGAATG
CATTAATATTGACGGCGCCCAGAACAATTGTCGCTTCAAAATGACCGTCA
CAATCAACGAAAAGAAGTTCGATGGAACAGGTCCTTCCAAAAAGACGGCG
AAAAATGCGGCAGCTAAGGCGGCACTTGCTTCGTTATGCAATATTTCCTA
CAGTCCAATGGTGGTGCCACAGAAGAACGTACCCCTGCCAATCGACGACA
AGTCGTCATCGATGGAGTTGCCTCAGATACACGCGGATACGATTGGTCGG
TTGGTCTTAGAAAAGTTCATGGAAGTAATCAAGGGCCAGGAGGCTTACTC
GCGTCGAAAGGTATTAGCGGGCATTGTAATGACTGAAAACATGAATTTTT
GTGAAGCCAAAGTTATTTCAGTTTCGACGGGCACCAAGTGTGTCAGCGGT
GAGCATATGAGTGTGAACGGAGCTGTCCTAAATGATTCCCATGCTGAAAT
AGTCTCCAGGCGTTGTCTTCTCAAATATTTATATGCACAGCTGGACCTTC
AGTGCAATCAGGGTATAGTTGTTTGATGTATATGCTAAGTTCAGTTTACG
TATACTAATAATACCATAGAACTTAAATCTAAGAGTAATGCATAATCTAG
TTGTTAAATGTTGATATCGAAAATGTACGCTTTACCAGCAAGAATTGCCT
ACATAGAAGCTAAAGTTCCGATTTGTGCTCATTAACCGTATACGAGCACA
AACTTTTATTTTTTCTTTCTTTTACACATTATAAACAAGCACTTTAAGCT
AACTTATGTTTTCCCCGTCTGATCGTTTTAGAAGGTGTTTATACAAAATT
AAATTTTAAGGGCAAACCATCTTAAAAATAAACAATTTGTAAACATTAAA
AAAAAAAAAAAAAAAA

LD32961.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:50:59
Subject Length Description Subject Range Query Range Score Percent Strand
Adar.c 2066 Adar.c 60..2007 1..1948 9740 100 Plus
Adar-RC 3523 Adar-RC 60..1056 1..997 4985 100 Plus
Adar.k 6820 Adar.k 161..1046 1..886 4430 100 Plus
Adar-RC 3523 Adar-RC 1749..2363 998..1612 3075 100 Plus
Adar.k 6820 Adar.k 1047..1661 998..1612 3075 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:00:17
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 1674533..1675018 1462..1947 2415 99.8 Plus
chrX 22417052 chrX 1667640..1668082 1..443 2215 100 Plus
chrX 22417052 chrX 1674187..1674471 1179..1463 1425 100 Plus
chrX 22417052 chrX 1672946..1673227 716..997 1410 100 Plus
chrX 22417052 chrX 1673920..1674104 998..1182 925 100 Plus
chrX 22417052 chrX 1672672..1672820 571..719 745 100 Plus
chrX 22417052 chrX 1672470..1672557 484..571 440 100 Plus
chrX 22417052 chrX 1669555..1669596 442..483 210 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:27:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:00:14
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1780675..1781161 1462..1948 2435 100 Plus
X 23542271 X 1773780..1774222 1..443 2215 100 Plus
X 23542271 X 1780329..1780613 1179..1463 1425 100 Plus
X 23542271 X 1779088..1779369 716..997 1410 100 Plus
X 23542271 X 1780062..1780246 998..1182 925 100 Plus
X 23542271 X 1778814..1778962 571..719 745 100 Plus
X 23542271 X 1778612..1778699 484..571 440 100 Plus
X 23542271 X 1775697..1775738 442..483 210 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:47:43
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 1788773..1789259 1462..1948 2435 100 Plus
X 23527363 X 1781878..1782320 1..443 2215 100 Plus
X 23527363 X 1788427..1788711 1179..1463 1425 100 Plus
X 23527363 X 1787186..1787467 716..997 1410 100 Plus
X 23527363 X 1788160..1788344 998..1182 925 100 Plus
X 23527363 X 1786912..1787060 571..719 745 100 Plus
X 23527363 X 1786710..1786797 484..571 440 100 Plus
X 23527363 X 1783795..1783836 442..483 210 100 Plus
Blast to na_te.dros performed on 2019-03-15 21:00:15 has no hits.

LD32961.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:01:30 Download gff for LD32961.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 1669557..1669596 444..483 100 -> Plus
chrX 1672470..1672557 484..571 100 -> Plus
chrX 1672673..1672818 572..717 100 -> Plus
chrX 1667640..1668082 1..443 100 -> Plus
chrX 1672948..1673227 718..997 100 -> Plus
chrX 1673920..1674102 998..1180 100 -> Plus
chrX 1674189..1674469 1181..1461 100 -> Plus
chrX 1674533..1675018 1462..1947 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:56:15 Download gff for LD32961.complete
Subject Subject Range Query Range Percent Splice Strand
Adar-RB 18..427 478..886 99 == Plus
Adar-RB 428..1048 998..1618 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:36:15 Download gff for LD32961.complete
Subject Subject Range Query Range Percent Splice Strand
Adar-RB 18..427 478..886 99 == Plus
Adar-RB 428..1048 998..1618 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:33:24 Download gff for LD32961.complete
Subject Subject Range Query Range Percent Splice Strand
Adar-RK 1..1179 448..1626 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:39:33 Download gff for LD32961.complete
Subject Subject Range Query Range Percent Splice Strand
Adar-RK 1..1179 448..1626 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-30 10:16:37 Download gff for LD32961.complete
Subject Subject Range Query Range Percent Splice Strand
Adar-RC 31..1027 1..997 100 -> Plus
Adar-RC 1720..2340 998..1618 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:36:15 Download gff for LD32961.complete
Subject Subject Range Query Range Percent Splice Strand
Adar-RC 31..1027 1..997 100 -> Plus
Adar-RC 1720..2340 998..1618 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:33:24 Download gff for LD32961.complete
Subject Subject Range Query Range Percent Splice Strand
Adar-RD 56..2002 1..1947 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:39:33 Download gff for LD32961.complete
Subject Subject Range Query Range Percent Splice Strand
Adar-RD 56..2002 1..1947 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:01:30 Download gff for LD32961.complete
Subject Subject Range Query Range Percent Splice Strand
X 1773780..1774222 1..443 100 -> Plus
X 1775699..1775738 444..483 100 -> Plus
X 1778612..1778699 484..571 100 -> Plus
X 1778815..1778960 572..717 100 -> Plus
X 1779090..1779369 718..997 100 -> Plus
X 1780062..1780244 998..1180 100 -> Plus
X 1780331..1780611 1181..1461 100 -> Plus
X 1780675..1781160 1462..1947 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:01:30 Download gff for LD32961.complete
Subject Subject Range Query Range Percent Splice Strand
X 1773780..1774222 1..443 100 -> Plus
X 1775699..1775738 444..483 100 -> Plus
X 1778612..1778699 484..571 100 -> Plus
X 1778815..1778960 572..717 100 -> Plus
X 1779090..1779369 718..997 100 -> Plus
X 1780062..1780244 998..1180 100 -> Plus
X 1780331..1780611 1181..1461 100 -> Plus
X 1780675..1781160 1462..1947 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:01:30 Download gff for LD32961.complete
Subject Subject Range Query Range Percent Splice Strand
X 1773780..1774222 1..443 100 -> Plus
X 1775699..1775738 444..483 100 -> Plus
X 1778612..1778699 484..571 100 -> Plus
X 1778815..1778960 572..717 100 -> Plus
X 1779090..1779369 718..997 100 -> Plus
X 1780062..1780244 998..1180 100 -> Plus
X 1780331..1780611 1181..1461 100 -> Plus
X 1780675..1781160 1462..1947 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:33:24 Download gff for LD32961.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 1672645..1672732 484..571 100 -> Plus
arm_X 1672848..1672993 572..717 100 -> Plus
arm_X 1674095..1674277 998..1180 100 -> Plus
arm_X 1673123..1673402 718..997 100 -> Plus
arm_X 1667813..1668255 1..443 100 -> Plus
arm_X 1669732..1669771 444..483 100 -> Plus
arm_X 1674364..1674644 1181..1461 100 -> Plus
arm_X 1674708..1675193 1462..1947 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:19:36 Download gff for LD32961.complete
Subject Subject Range Query Range Percent Splice Strand
X 1781878..1782320 1..443 100 -> Plus
X 1783797..1783836 444..483 100 -> Plus
X 1786710..1786797 484..571 100 -> Plus
X 1786913..1787058 572..717 100 -> Plus
X 1787188..1787467 718..997 100 -> Plus
X 1788160..1788342 998..1180 100 -> Plus
X 1788429..1788709 1181..1461 100 -> Plus
X 1788773..1789258 1462..1947 100   Plus

LD32961.pep Sequence

Translation from 447 to 1625

> LD32961.pep
MLNSANNNSPQHPVSAPSDINMNGYNRKLPQKRGYEMPKYSDPKKKMCKE
RIPQPKNTVAMLNELRHGLIYKLESQTGPVHAPLFTISVEVDGQKYLGQG
RSKKVARIEAAATALRSFIQFKDGAVLSPLKPAGNLDFTSDEHLENGIEN
LSSSKMFEIIQTMLTEKLSNPTSLEQPTFCMSQNVSKSAITVDGQKKVPD
KGPVMLLYELFNDVNFECINIDGAQNNCRFKMTVTINEKKFDGTGPSKKT
AKNAAAKAALASLCNISYSPMVVPQKNVPLPIDDKSSSMELPQIHADTIG
RLVLEKFMEVIKGQEAYSRRKVLAGIVMTENMNFCEAKVISVSTGTKCVS
GEHMSVNGAVLNDSHAEIVSRRCLLKYLYAQLDLQCNQGIVV*

LD32961.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:59:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22002-PA 556 GF22002-PA 15..275 91..388 1329 86.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:59:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12877-PA 632 GG12877-PA 1..352 1..389 1805 88.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:59:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24441-PA 633 GH24441-PA 1..352 1..388 1599 82.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:33
Subject Length Description Subject Range Query Range Score Percent Strand
Adar-PD 392 CG12598-PD 1..392 1..392 2016 100 Plus
Adar-PK 392 CG12598-PK 1..392 1..392 2016 100 Plus
Adar-PN 669 CG12598-PN 1..388 1..388 1998 100 Plus
Adar-PJ 389 CG12598-PJ 8..389 11..392 1961 99.7 Plus
Adar-PH 665 CG12598-PH 9..384 13..388 1933 100 Plus
Adar-PO 355 CG12598-PO 1..355 1..392 1778 90.3 Plus
Adar-PI 632 CG12598-PI 1..351 1..388 1760 90.2 Plus
Adar-PA 632 CG12598-PA 1..351 1..388 1760 90.2 Plus
Adar-PE 634 CG12598-PE 15..353 13..388 1695 89.9 Plus
Adar-PB 628 CG12598-PB 9..347 13..388 1695 89.9 Plus
Adar-PP 334 CG12598-PP 1..334 22..392 1667 89.8 Plus
Adar-PF 611 CG12598-PF 1..330 22..388 1649 89.6 Plus
Adar-PC 186 CG12598-PC 1..184 1..184 948 99.5 Plus
Adar-PM 188 CG12598-PM 15..186 13..184 883 99.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:59:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16028-PA 633 GI16028-PA 1..352 1..388 1602 82.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:59:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14352-PA 619 GL14352-PA 1..339 1..389 1596 80.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:59:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11711-PA 633 GA11711-PA 1..353 1..389 1615 83.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:59:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19166-PA 602 GM19166-PA 9..348 13..389 1653 87.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:59:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18414-PA 633 GJ18414-PA 1..352 1..388 1598 82.5 Plus
Dvir\GJ18090-PA 417 GJ18090-PA 14..97 299..382 161 40 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:59:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25300-PA 720 GK25300-PA 109..440 22..389 1503 81.6 Plus
Dwil\GK16285-PA 403 GK16285-PA 6..92 297..383 155 39.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:59:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16707-PA 632 GE16707-PA 1..352 1..389 1805 88.7 Plus

LD32961.hyp Sequence

Translation from 447 to 1625

> LD32961.hyp
MLNSANNNSPQHPVSAPSDINMNGYNRKLPQKRGYEMPKYSDPKKKMCKE
RIPQPKNTVAMLNELRHGLIYKLESQTGPVHAPLFTISVEVDGQKYLGQG
RSKKVARIEAAATALRSFIQFKDGAVLSPLKPAGNLDFTSDEHLENGIEN
LSSSKMFEIIQTMLTEKLSNPTSLEQPTFCMSQNVSKSAITVDGQKKVPD
KGPVMLLYELFNDVNFECINIDGAQNNCRFKMTVTINEKKFDGTGPSKKT
AKNAAAKAALASLCNISYSPMVVPQKNVPLPIDDKSSSMELPQIHADTIG
RLVLEKFMEVIKGQEAYSRRKVLAGIVMTENMNFCEAKVISVSTGTKCVS
GEHMSVNGAVLNDSHAEIVSRRCLLKYLYAQLDLQCNQGIVV*

LD32961.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:15:03
Subject Length Description Subject Range Query Range Score Percent Strand
Adar-PD 392 CG12598-PD 1..392 1..392 2016 100 Plus
Adar-PK 392 CG12598-PK 1..392 1..392 2016 100 Plus
Adar-PN 669 CG12598-PN 1..388 1..388 1998 100 Plus
Adar-PJ 389 CG12598-PJ 8..389 11..392 1961 99.7 Plus
Adar-PH 665 CG12598-PH 9..384 13..388 1933 100 Plus