Clone LD32963 Report

Search the DGRC for LD32963

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:329
Well:63
Vector:pOT2
Associated Gene/Transcriptcbx-RA
Protein status:LD32963.pep: gold
Sequenced Size:1055

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10536 2002-11-13 Blastp of sequenced clone
cbx 2008-04-29 Release 5.5 accounting
cbx 2008-08-15 Release 5.9 accounting
cbx 2008-12-18 5.12 accounting

Clone Sequence Records

LD32963.complete Sequence

1055 bp (1055 high quality bases) assembled on 2002-11-13

GenBank Submission: BT001497

> LD32963.complete
AAATTGGTTCAATTCTGGTGGTACAGTTAGCATAATATTCTTTTCTTTTT
AAACCTACCCAGCATTATGTAATCGATTTAGGAGTATTTATAGTAAAACG
AATATAAGGCTTGCAACTTAGCCGAAAAATGTGCGATCATATTTAAACCG
CTTCCAAATCTGAAAAGAAGAAACGTGAACAATAAATATTTTTATGTACA
TACATATGAACATATTTATATATGTATGTATGTGTATAATAATTCTGTAT
ATATGACAAGTTGCTGATCACAACCATACAGCAGGAGTATAAAATTCTGG
CCGAATACAAAATGATTGAGTCGGAGAAGTTGAGTGGGATATATGTGATA
CCCAGCTATGCTAACTCCTTGCAGTGGTTTGGAGTCTTCTTTGGCCGACA
GGGCTTGTATGCGGAAAGTGTTTTTCGATTCACAATTTTGCTCCCAGATC
GTTTTCCCGACGACAAAAGTCTTCCGAGCATAATTTTCCAGCAGGATGTG
ATTCATCCCCATGTGTGCCCGTACACCCACAGTTTGGACGTGAGCCACGC
CTTCCCGGAGTGGCGCTGTGGAGAGGATCACCTTTGGCAGCTTTTAAAGT
ACCTGCAAGTCATTTTCTCCGATCCCTTGGACAGTATTCGGGGCATTGAG
GTAGATAAGCTCAAAAACAGCGAGGCTGCGGAGCTGCTGATGAATAACAA
GGAGGAGTATGTTGCTCGCGTACAGGAAAATATCAAGGAGAGCAAGGAGC
ATATATTTGACACCCCACCCACCGAAGATCCGCACTACATAGTATTCGAG
AAGTTCCAGCAGGACGTGCACGGGCCCGTTCTGGAGCGCATCAAGGCCGG
AAGAAGCAAGCTGACGGAGCCTTCAGCGCAACAAGCAAATGGTGGACATG
CAACTGGTCTGTCATGGGTTAAGGAGGGCGAGTTTAAGCCACTTAGCATT
GAGTAAAACCAATATACATATATTCTGTAAGTTATATTCTATCGTTGTCT
CAATTTTAAAACGATTAAAGTTATTCAATTATTTACAAAAAAAAAAAAAA
AAAAA

LD32963.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:33:29
Subject Length Description Subject Range Query Range Score Percent Strand
cbx-RA 1038 cbx-RA 1..1038 1..1038 5190 100 Plus
cbx-RB 969 cbx-RB 127..912 253..1038 3930 100 Plus
CG30010-RA 899 CG30010-RA 805..899 1038..944 475 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:27:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 5751988..5752548 1036..476 2805 100 Minus
chr2R 21145070 chr2R 5762304..5762555 252..1 1230 99.2 Minus
chr2R 21145070 chr2R 5752602..5752705 476..373 520 100 Minus
chr2R 21145070 chr2R 5752768..5752832 372..308 325 100 Minus
chr2R 21145070 chr2R 5752902..5752956 307..253 275 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:27:03 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:27:24
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9864508..9865070 1038..476 2815 100 Minus
2R 25286936 2R 9874821..9875072 252..1 1260 100 Minus
2R 25286936 2R 9865124..9865227 476..373 520 100 Minus
2R 25286936 2R 9865290..9865354 372..308 325 100 Minus
2R 25286936 2R 9865424..9865478 307..253 275 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:08:40
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 9865707..9866269 1038..476 2815 100 Minus
2R 25260384 2R 9876020..9876271 252..1 1260 100 Minus
2R 25260384 2R 9866323..9866426 476..373 520 100 Minus
2R 25260384 2R 9866489..9866553 372..308 325 100 Minus
2R 25260384 2R 9866623..9866677 307..253 275 100 Minus
Blast to na_te.dros performed 2019-03-15 22:27:24
Subject Length Description Subject Range Query Range Score Percent Strand
FB 1106 FB DMTNFB 1106bp AKA(J01084) Derived from V00246 (g8708) (Rel. 36, Last updated, Version 3). 252..383 86..219 115 59.1 Plus
HMS-Beagle2 7220 HMS-Beagle2 Beagle2 7220bp 6260..6310 982..1032 111 68.6 Plus

LD32963.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:28:30 Download gff for LD32963.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 5762375..5762555 1..181 99   Minus
chr2R 5751988..5752547 477..1036 100 <- Minus
chr2R 5752602..5752705 373..476 100 <- Minus
chr2R 5752768..5752832 308..372 100 <- Minus
chr2R 5752902..5752956 253..307 100 == Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:56:15 Download gff for LD32963.complete
Subject Subject Range Query Range Percent Splice Strand
cbx-RB 32..735 253..956 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:04:37 Download gff for LD32963.complete
Subject Subject Range Query Range Percent Splice Strand
cbx-RB 32..735 253..956 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:20:26 Download gff for LD32963.complete
Subject Subject Range Query Range Percent Splice Strand
cbx-RB 32..735 253..956 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:54:51 Download gff for LD32963.complete
Subject Subject Range Query Range Percent Splice Strand
cbx-RB 32..735 253..956 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:23:13 Download gff for LD32963.complete
Subject Subject Range Query Range Percent Splice Strand
cbx-RB 32..735 253..956 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:56:14 Download gff for LD32963.complete
Subject Subject Range Query Range Percent Splice Strand
cbx-RA 1..1036 1..1036 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:04:37 Download gff for LD32963.complete
Subject Subject Range Query Range Percent Splice Strand
cbx-RA 1..1036 1..1036 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:20:26 Download gff for LD32963.complete
Subject Subject Range Query Range Percent Splice Strand
cbx-RA 1..1036 1..1036 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:54:51 Download gff for LD32963.complete
Subject Subject Range Query Range Percent Splice Strand
cbx-RA 1..1036 1..1036 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:23:13 Download gff for LD32963.complete
Subject Subject Range Query Range Percent Splice Strand
cbx-RA 1..1036 1..1036 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:28:30 Download gff for LD32963.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9864510..9865069 477..1036 100 <- Minus
2R 9865124..9865227 373..476 100 <- Minus
2R 9865290..9865354 308..372 100 <- Minus
2R 9865424..9865478 253..307 100 <- Minus
2R 9874821..9875072 1..252 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:28:30 Download gff for LD32963.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9864510..9865069 477..1036 100 <- Minus
2R 9865124..9865227 373..476 100 <- Minus
2R 9865290..9865354 308..372 100 <- Minus
2R 9865424..9865478 253..307 100 <- Minus
2R 9874821..9875072 1..252 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:28:30 Download gff for LD32963.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9864510..9865069 477..1036 100 <- Minus
2R 9865124..9865227 373..476 100 <- Minus
2R 9865290..9865354 308..372 100 <- Minus
2R 9865424..9865478 253..307 100 <- Minus
2R 9874821..9875072 1..252 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:20:26 Download gff for LD32963.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5752015..5752574 477..1036 100 <- Minus
arm_2R 5752629..5752732 373..476 100 <- Minus
arm_2R 5752795..5752859 308..372 100 <- Minus
arm_2R 5752929..5752983 253..307 100 <- Minus
arm_2R 5762326..5762577 1..252 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:27:09 Download gff for LD32963.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9865709..9866268 477..1036 100 <- Minus
2R 9866323..9866426 373..476 100 <- Minus
2R 9866489..9866553 308..372 100 <- Minus
2R 9866623..9866677 253..307 100 <- Minus
2R 9876020..9876271 1..252 100   Minus

LD32963.pep Sequence

Translation from 311 to 955

> LD32963.pep
MIESEKLSGIYVIPSYANSLQWFGVFFGRQGLYAESVFRFTILLPDRFPD
DKSLPSIIFQQDVIHPHVCPYTHSLDVSHAFPEWRCGEDHLWQLLKYLQV
IFSDPLDSIRGIEVDKLKNSEAAELLMNNKEEYVARVQENIKESKEHIFD
TPPTEDPHYIVFEKFQQDVHGPVLERIKAGRSKLTEPSAQQANGGHATGL
SWVKEGEFKPLSIE*

LD32963.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:05:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13050-PA 242 GF13050-PA 31..242 1..214 1017 86 Plus
Dana\GF13159-PA 266 GF13159-PA 29..211 5..179 451 43.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:05:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25253-PA 244 GG25253-PA 31..244 1..214 1106 95.3 Plus
Dere\GG20882-PA 266 GG20882-PA 29..211 5..179 465 44.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:05:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20212-PA 246 GH20212-PA 31..246 1..214 746 67.3 Plus
Dgri\GH22748-PA 211 GH22748-PA 28..206 1..175 490 50.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:48:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG46338-PA 214 CG46338-PA 1..214 1..214 1139 100 Plus
CG46338-PB 244 CG46338-PB 31..244 1..214 1139 100 Plus
CG46338-PC 183 CG46338-PC 1..183 1..214 937 85.5 Plus
CG16894-PA 266 CG16894-PA 29..211 5..179 457 45.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:05:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20739-PA 245 GI20739-PA 31..245 1..214 845 71 Plus
Dmoj\GI18531-PA 256 GI18531-PA 28..213 1..180 511 47.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:05:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10235-PA 244 GL10235-PA 31..244 1..214 982 81.8 Plus
Dper\GL11711-PA 262 GL11711-PA 26..228 1..190 447 43.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:05:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10380-PA 244 GA10380-PA 31..244 1..214 982 81.8 Plus
Dpse\GA10380-PB 214 GA10380-PB 1..214 1..214 976 81.8 Plus
Dpse\GA14202-PA 262 GA14202-PA 26..228 1..190 440 42.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:05:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20572-PA 244 GM20572-PA 31..244 1..214 1118 97.2 Plus
Dsec\GM19805-PA 266 GM19805-PA 29..211 5..179 455 45.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:05:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10043-PA 244 GD10043-PA 31..244 1..214 1128 98.1 Plus
Dsim\GD25298-PA 188 GD25298-PA 29..151 5..126 291 46.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:05:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20476-PA 245 GJ20476-PA 31..245 1..214 831 70 Plus
Dvir\GJ21397-PA 256 GJ21397-PA 28..212 1..179 517 48.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:05:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21357-PA 251 GK21357-PA 31..251 1..214 875 73.8 Plus
Dwil\GK15683-PA 273 GK15683-PA 26..211 1..178 514 48.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:05:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21973-PA 244 GE21973-PA 31..244 1..214 1101 94.9 Plus
Dyak\GE13821-PA 266 GE13821-PA 29..211 5..179 454 44.3 Plus

LD32963.hyp Sequence

Translation from 311 to 955

> LD32963.hyp
MIESEKLSGIYVIPSYANSLQWFGVFFGRQGLYAESVFRFTILLPDRFPD
DKSLPSIIFQQDVIHPHVCPYTHSLDVSHAFPEWRCGEDHLWQLLKYLQV
IFSDPLDSIRGIEVDKLKNSEAAELLMNNKEEYVARVQENIKESKEHIFD
TPPTEDPHYIVFEKFQQDVHGPVLERIKAGRSKLTEPSAQQANGGHATGL
SWVKEGEFKPLSIE*

LD32963.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:20:08
Subject Length Description Subject Range Query Range Score Percent Strand
cbx-PA 214 CG10536-PA 1..214 1..214 1139 100 Plus
cbx-PB 244 CG10536-PB 31..244 1..214 1139 100 Plus
cbx-PC 183 CG10536-PC 1..183 1..214 937 85.5 Plus
CG16894-PA 266 CG16894-PA 29..211 5..179 457 45.4 Plus