Clone LD33318 Report

Search the DGRC for LD33318

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:333
Well:18
Vector:pOT2
Associated Gene/TranscriptProsalpha5-RA
Protein status:LD33318.pep: gold
Preliminary Size:1109
Sequenced Size:888

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10938 2001-01-01 Release 2 assignment
CG10938 2001-10-10 Blastp of sequenced clone
CG10938 2003-01-01 Sim4 clustering to Release 3
ProsMA5 2008-04-29 Release 5.5 accounting
ProsMA5 2008-08-15 Release 5.9 accounting
ProsMA5 2008-12-18 5.12 accounting

Clone Sequence Records

LD33318.complete Sequence

888 bp (888 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061404

> LD33318.complete
TCATTTCAGCGTCAAGTCATCCGGCATTTGTTTGCGATTTTGTTAAGGAA
ATTATAGAAAACCCACCATGTTTCTCACGCGTTCCGAGTACGACAGAGGC
GTGAACACCTTCTCGCCGGAGGGCCGCCTCTTCCAAGTGGAATATGCCAT
TGAGGCCATCAAATTGGGCTCCACAGCAATTGGAATTTGCACGCCAGAAG
GAGTGGTTTTGGCGGTGGAGAAGCGCATCACTTCGCCGCTAATGGTACCC
AGTACTGTGGAGAAGATTGTGGAGGTGGACAAGCACATTGGTTGCGCCAC
CTCCGGCTTGATGGCCGATGCCAGGACTCTGATCGAGAGGGCACGCGTGG
AGTGCCAGAACCACTGGTTCGTCTACAACGAGCGCATGTCCATCGAGTCC
TGCGCCCAGGCTGTGTCCACTTTGGCCATCCAGTTCGGTGATAGTGGCGA
CAGCGATGGTGCCGCCGCCATGAGTCGTCCCTTTGGTGTGGCCATTCTAT
TTGCCGGCATCGAGGCGGGACAACCCCAGTTGTGGCACATGGATCCCTCC
GGCACATTCGTGCGCCACGGAGCCAAGGCCATTGGCTCGGGCAGCGAAGG
TGCTCAGCAGAATCTGCAGGACTTATTTAGACCCGATTTGACTCTCGATG
AGGCTATCGACATTTCGCTCAACACACTTAAACAGGTTATGGAGGAGAAA
CTAAACTCCACCAATGTGGAGGTGATGACCATGACGAAAGAAAGAGAGTT
CTACATGTTCACCAAGGAGGAGGTGGAGCAGCACATTAAGAACATTGCGT
AAGCGGCAGTGGTTTTAAATTGATCTAATTTCAAATGTAATGTGAATAAA
GAAAGGGATTCTAAATCGAAAAAAAAAAAAAAAAAAAA

LD33318.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:14:58
Subject Length Description Subject Range Query Range Score Percent Strand
Prosalpha5-RA 1143 Prosalpha5-RA 129..998 1..870 4350 100 Plus
Prosalpha5-RB 1013 Prosalpha5-RB 147..955 62..870 4045 100 Plus
Prosalpha5-RB 1013 Prosalpha5-RB 25..85 1..61 305 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 13:42:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 13300156..13300825 199..868 3350 100 Plus
chr2R 21145070 chr2R 13299961..13300100 62..201 700 100 Plus
chr2R 21145070 chr2R 13299839..13299899 1..61 305 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:27:29 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 13:42:38
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17413100..17413771 199..870 3360 100 Plus
2R 25286936 2R 17412905..17413044 62..201 700 100 Plus
2R 25286936 2R 17412783..17412843 1..61 305 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:38:38
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 17414299..17414970 199..870 3360 100 Plus
2R 25260384 2R 17414104..17414243 62..201 700 100 Plus
2R 25260384 2R 17413982..17414042 1..61 305 100 Plus
Blast to na_te.dros performed on 2019-03-15 13:42:38 has no hits.

LD33318.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 13:43:43 Download gff for LD33318.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 13299961..13300099 62..200 100 -> Plus
chr2R 13299839..13299899 1..61 100 -> Plus
chr2R 13300158..13300825 201..868 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:15:02 Download gff for LD33318.complete
Subject Subject Range Query Range Percent Splice Strand
ProsMA5-RB 1..735 68..802 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:56:07 Download gff for LD33318.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha5-RB 1..735 68..802 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 22:10:00 Download gff for LD33318.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha5-RA 1..735 68..802 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:25:16 Download gff for LD33318.complete
Subject Subject Range Query Range Percent Splice Strand
ProsMA5-RB 1..735 68..802 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:38:34 Download gff for LD33318.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha5-RA 1..735 68..802 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:42:04 Download gff for LD33318.complete
Subject Subject Range Query Range Percent Splice Strand
ProsMA5-RA 20..887 1..868 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:56:07 Download gff for LD33318.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha5-RA 20..887 1..868 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 22:10:00 Download gff for LD33318.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha5-RA 17..884 1..868 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:25:17 Download gff for LD33318.complete
Subject Subject Range Query Range Percent Splice Strand
ProsMA5-RA 10..877 1..868 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:38:34 Download gff for LD33318.complete
Subject Subject Range Query Range Percent Splice Strand
Prosalpha5-RA 17..884 1..868 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:43:43 Download gff for LD33318.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17412783..17412843 1..61 100 -> Plus
2R 17412905..17413043 62..200 100 -> Plus
2R 17413102..17413769 201..868 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:43:43 Download gff for LD33318.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17412783..17412843 1..61 100 -> Plus
2R 17412905..17413043 62..200 100 -> Plus
2R 17413102..17413769 201..868 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:43:43 Download gff for LD33318.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17412783..17412843 1..61 100 -> Plus
2R 17412905..17413043 62..200 100 -> Plus
2R 17413102..17413769 201..868 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 22:10:00 Download gff for LD33318.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13300288..13300348 1..61 100 -> Plus
arm_2R 13300410..13300548 62..200 100 -> Plus
arm_2R 13300607..13301274 201..868 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:02:27 Download gff for LD33318.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17414301..17414968 201..868 100   Plus
2R 17413982..17414042 1..61 100 -> Plus
2R 17414104..17414242 62..200 100 -> Plus

LD33318.hyp Sequence

Translation from 67 to 801

> LD33318.hyp
MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGICTPEGVVLAV
EKRITSPLMVPSTVEKIVEVDKHIGCATSGLMADARTLIERARVECQNHW
FVYNERMSIESCAQAVSTLAIQFGDSGDSDGAAAMSRPFGVAILFAGIEA
GQPQLWHMDPSGTFVRHGAKAIGSGSEGAQQNLQDLFRPDLTLDEAIDIS
LNTLKQVMEEKLNSTNVEVMTMTKEREFYMFTKEEVEQHIKNIA*

LD33318.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:51:43
Subject Length Description Subject Range Query Range Score Percent Strand
Prosalpha5-PB 244 CG10938-PB 1..244 1..244 1244 100 Plus
Prosalpha5-PA 244 CG10938-PA 1..244 1..244 1244 100 Plus
Prosalpha2-PA 234 CG5266-PA 1..210 3..219 342 33.2 Plus
Prosalpha4-PA 249 CG3422-PA 3..234 6..243 335 33.6 Plus
Prosalpha4T1-PA 249 CG17268-PA 3..232 6..241 315 32.2 Plus

LD33318.pep Sequence

Translation from 67 to 801

> LD33318.pep
MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGICTPEGVVLAV
EKRITSPLMVPSTVEKIVEVDKHIGCATSGLMADARTLIERARVECQNHW
FVYNERMSIESCAQAVSTLAIQFGDSGDSDGAAAMSRPFGVAILFAGIEA
GQPQLWHMDPSGTFVRHGAKAIGSGSEGAQQNLQDLFRPDLTLDEAIDIS
LNTLKQVMEEKLNSTNVEVMTMTKEREFYMFTKEEVEQHIKNIA*

LD33318.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 10:03:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13117-PA 243 GF13117-PA 1..243 1..244 1139 87.3 Plus
Dana\GF17957-PA 234 GF17957-PA 1..233 3..243 374 32.4 Plus
Dana\GF19028-PA 249 GF19028-PA 3..231 6..240 358 33.6 Plus
Dana\GF15751-PA 285 GF15751-PA 4..238 5..239 298 32 Plus
Dana\GF11246-PA 252 GF11246-PA 5..175 8..184 293 35.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 10:03:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20675-PA 244 GG20675-PA 1..244 1..244 1222 93 Plus
Dere\GG15180-PA 251 GG15180-PA 3..222 6..231 358 35.4 Plus
Dere\GG18927-PA 234 GG18927-PA 6..210 8..219 352 34 Plus
Dere\GG17945-PA 249 GG17945-PA 3..213 6..220 343 35.3 Plus
Dere\GG10092-PA 282 GG10092-PA 1..237 1..240 316 34.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 10:03:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21393-PA 245 GH21393-PA 1..244 1..243 1105 83.2 Plus
Dgri\GH13898-PA 234 GH13898-PA 6..233 8..243 365 32.6 Plus
Dgri\GH12557-PA 249 GH12557-PA 3..231 6..240 359 34.5 Plus
Dgri\GH20892-PA 254 GH20892-PA 5..176 8..185 304 36.3 Plus
Dgri\GH20521-PA 263 GH20521-PA 5..238 8..240 298 33.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:27:14
Subject Length Description Subject Range Query Range Score Percent Strand
Prosalpha5-PB 244 CG10938-PB 1..244 1..244 1244 100 Plus
Prosalpha5-PA 244 CG10938-PA 1..244 1..244 1244 100 Plus
Prosalpha2-PA 234 CG5266-PA 1..210 3..219 342 33.2 Plus
Prosalpha4-PA 249 CG3422-PA 3..234 6..243 335 33.6 Plus
Prosalpha4T1-PA 249 CG17268-PA 3..232 6..241 315 32.2 Plus
Prosalpha4T2-PB 252 CG4569-PB 5..214 8..222 303 35.5 Plus
Prosalpha4T2-PA 252 CG4569-PA 5..214 8..222 303 35.5 Plus
Prosalpha1-PB 244 CG18495-PB 9..241 8..244 298 28.7 Plus
Prosalpha1-PA 244 CG18495-PA 9..241 8..244 298 28.7 Plus
CG30382-PB 244 CG30382-PB 9..241 8..244 298 28.7 Plus
CG30382-PA 244 CG30382-PA 9..241 8..244 298 28.7 Plus
Prosalpha6T-PA 289 CG5648-PA 3..233 5..241 283 30.4 Plus
Prosalpha6-PA 279 CG4904-PA 3..236 5..240 281 30.5 Plus
Prosalpha6-PB 279 CG4904-PB 3..236 5..240 281 30.5 Plus
Prosalpha3-PA 264 CG9327-PA 5..241 8..241 278 33.7 Plus
Prosalpha7-PA 253 CG1519-PA 8..203 8..210 254 31.9 Plus
Prosalpha3T-PA 251 CG1736-PA 5..240 8..241 239 28.8 Plus
Prosbeta5R2-PB 279 CG31742-PB 71..227 34..200 175 28 Plus
Prosbeta5R2-PA 279 CG31742-PA 71..227 34..200 175 28 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 10:03:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18573-PA 245 GI18573-PA 1..245 1..244 1048 81.2 Plus
Dmoj\GI24829-PA 234 GI24829-PA 6..233 8..243 366 32.6 Plus
Dmoj\GI11210-PA 249 GI11210-PA 3..231 6..240 346 34 Plus
Dmoj\GI18257-PA 254 GI18257-PA 7..209 7..219 308 33.2 Plus
Dmoj\GI21067-PA 263 GI21067-PA 5..239 8..241 295 33.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 10:03:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11421-PA 244 GL11421-PA 1..244 1..244 1198 89.8 Plus
Dper\GL27312-PA 234 GL27312-PA 1..233 3..243 360 31.1 Plus
Dper\GL17442-PA 244 GL17442-PA 9..241 8..244 300 29.2 Plus
Dper\GL26115-PA 219 GL26115-PA 3..139 6..149 297 43.8 Plus
Dper\GL20413-PA 252 GL20413-PA 5..175 8..184 297 33.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:03:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10654-PA 244 GA10654-PA 1..244 1..244 1198 89.8 Plus
Dpse\GA25292-PA 249 GA25292-PA 3..234 6..243 367 35.3 Plus
Dpse\GA17441-PA 249 GA17441-PA 3..231 6..240 362 34.5 Plus
Dpse\GA18772-PA 234 GA18772-PA 1..233 3..243 360 31.1 Plus
Dpse\GA15805-PA 244 GA15805-PA 9..241 8..244 300 29.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 10:03:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21770-PA 244 GM21770-PA 1..244 1..244 1235 93.9 Plus
Dsec\GM24033-PA 234 GM24033-PA 6..210 8..219 353 34 Plus
Dsec\Pros28.1A-PA 251 GM23164-PA 3..222 6..231 341 34.5 Plus
Dsec\GM20751-PA 244 GM20751-PA 9..241 8..244 317 30 Plus
Dsec\Pros28.1B-PA 252 GM11825-PA 5..223 8..231 314 34.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 10:03:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11263-PA 244 GD11263-PA 1..244 1..244 1241 94.3 Plus
Dsim\GD18834-PA 234 GD18834-PA 6..210 8..219 353 34 Plus
Dsim\Pros28.1A-PA 251 GD20037-PA 3..222 6..231 348 34.9 Plus
Dsim\GD10216-PA 244 GD10216-PA 9..241 8..244 317 30 Plus
Dsim\Pros28.1B-PA 252 GD24946-PA 5..223 8..231 315 34.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 10:03:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20367-PA 245 GJ20367-PA 1..244 1..243 1080 80.7 Plus
Dvir\GJ24473-PA 234 GJ24473-PA 6..233 8..243 358 32.6 Plus
Dvir\Pros28.1-PA 249 GJ18504-PA 3..231 6..240 357 34.5 Plus
Dvir\Pros28.1B-PA 251 GJ19357-PA 2..174 6..184 326 38.3 Plus
Dvir\GJ16557-PA 234 GJ16557-PA 1..233 3..243 297 29.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 10:03:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21413-PA 245 GK21413-PA 1..245 1..244 1149 86.9 Plus
Dwil\GK14404-PA 234 GK14404-PA 6..233 8..243 354 32.2 Plus
Dwil\GK25669-PA 249 GK25669-PA 3..213 6..220 338 34.9 Plus
Dwil\GK21354-PA 244 GK21354-PA 9..241 8..244 305 29.2 Plus
Dwil\GK22956-PA 262 GK22956-PA 5..219 8..224 289 35 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 10:03:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\ProsMA5-PA 244 GE11658-PA 1..244 1..244 1217 92.6 Plus
Dyak\GE25043-PA 251 GE25043-PA 3..222 6..231 367 36.2 Plus
Dyak\GE26194-PA 234 GE26194-PA 6..210 8..219 358 34.4 Plus
Dyak\GE17253-PA 249 GE17253-PA 3..213 6..220 337 35.3 Plus
Dyak\Pros35-PA 286 GE18906-PA 6..242 5..241 322 33.3 Plus