Clone LD33485 Report

Search the DGRC for LD33485

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:334
Well:85
Vector:pOT2
Associated Gene/TranscriptmRpL4-RA
Protein status:LD33485.pep: gold
Preliminary Size:1186
Sequenced Size:992

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5818 2001-01-01 Release 2 assignment
CG5818 2001-10-10 Blastp of sequenced clone
CG5818 2003-01-01 Sim4 clustering to Release 3
mRpL4 2008-04-29 Release 5.5 accounting
mRpL4 2008-08-15 Release 5.9 accounting
mRpL4 2008-12-18 5.12 accounting

Clone Sequence Records

LD33485.complete Sequence

992 bp (992 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061407

> LD33485.complete
CTGCAAAGTAAAATGTTGAACAATATTTTAAAAACATCCAGGCAGGTGCT
TTATCCCGTAGCAAGGACTTTCAGCCGCAGCGGCAACCACGGCAATGTGG
TGACCGAAGCCGCTGCGACAGTGGGCGCACCTCCGGCCACAAGATCACCC
CTTATTCTGCCGCAAGATTACACAGATTGCTTGCCGGTGAGCAGGAACAC
GGCGCGCCAGGCATGGATTGAGAACACGGATGCTGTGGCGGAGCGAAAGG
TTGGCCTGATTGAACTGCATCCGGATGTCTTTGCCGCCCAGCCGCGCGTG
GACATCATACAGGAGAATGTGGAGTGGCAGAGCAAGTATCGTTATGTAAG
CATGGCGCACACCAAAACTCGAGCGGAGGTGCGCGGTGGTGGTCGGAAGC
CGTGGCCCCAAAAGGGAGGTGGTCGTGCCCGCCACGGTTCCCTCCGTTCG
CCCATGCTGAAGGGCGGCGGCGTAGTGCACGGACCCAGGTCGCCTACGAC
CCATTTTTACATGCTGCCCTTCTATAAGAGGGTTTTAGGATTGACCTCCA
CGCTGAGTGTTAAGCTGGCCCAGGATGATCTGCACATCATCGATAATGTG
GACATACCCACCGGAGATGCAGAGTTCCTTAAGGATTTAATCGCCGAACG
GAATTGGGGACCTTCTGTTTTGATTGTAGACGAAGACCATATGTTCCCCG
CCAATATTTGCCAGGCTAGCGATGATCTGGGCTATGTCAACCTGATGCCA
ACCTTTGGCTTGAACGTCTATTCTATGCTGAAGCACGATACTTTGGTGCT
GACAGTGGCTGCAGTGAAACATCTGGAGCAGCGCCTGCTCTACCAACTTA
ATCGAAACGACGCCGCCAGCAAGGGCGGCAAGTTTAAGCTGGATCAAGTC
TAGAAGTTAAGAAAGTTAAATCCTTTAGTTTATTTGTAACCTTTATGGAT
GCGCCAGAAAATGCATTGTTAAACAAAAAAAAAAAAAAAAAA

LD33485.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:15:00
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL4-RA 1140 mRpL4-RA 119..1098 1..980 4900 100 Plus
CG4278-RA 1061 CG4278-RA 983..1061 980..902 395 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:38:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 16327275..16327957 683..1 3370 99.6 Minus
chr2L 23010047 chr2L 16326922..16327212 974..684 1455 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:27:43 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:38:16
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16328412..16329094 683..1 3415 100 Minus
2L 23513712 2L 16328053..16328349 980..684 1485 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:38:39
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16328412..16329094 683..1 3415 100 Minus
2L 23513712 2L 16328053..16328349 980..684 1485 100 Minus
Blast to na_te.dros performed on 2019-03-16 16:38:17 has no hits.

LD33485.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:39:32 Download gff for LD33485.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 16326922..16327212 684..974 100 <- Minus
chr2L 16327275..16327957 1..683 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:15:17 Download gff for LD33485.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL4-RA 1..891 13..903 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:56:09 Download gff for LD33485.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL4-RA 1..891 13..903 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:20:54 Download gff for LD33485.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL4-RA 1..891 13..903 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:25:22 Download gff for LD33485.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL4-RA 1..891 13..903 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:36:42 Download gff for LD33485.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL4-RA 1..891 13..903 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:42:08 Download gff for LD33485.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL4-RA 35..1008 1..974 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:56:09 Download gff for LD33485.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL4-RA 35..1008 1..974 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:20:54 Download gff for LD33485.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL4-RA 39..1012 1..974 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:25:22 Download gff for LD33485.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL4-RA 35..1008 1..974 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:36:42 Download gff for LD33485.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL4-RA 39..1012 1..974 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:39:32 Download gff for LD33485.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16328059..16328349 684..974 100 <- Minus
2L 16328412..16329094 1..683 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:39:32 Download gff for LD33485.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16328059..16328349 684..974 100 <- Minus
2L 16328412..16329094 1..683 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:39:32 Download gff for LD33485.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16328059..16328349 684..974 100 <- Minus
2L 16328412..16329094 1..683 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:20:54 Download gff for LD33485.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16328059..16328349 684..974 100 <- Minus
arm_2L 16328412..16329094 1..683 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:02:30 Download gff for LD33485.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16328059..16328349 684..974 100 <- Minus
2L 16328412..16329094 1..683 100   Minus

LD33485.hyp Sequence

Translation from 0 to 902

> LD33485.hyp
LQSKMLNNILKTSRQVLYPVARTFSRSGNHGNVVTEAAATVGAPPATRSP
LILPQDYTDCLPVSRNTARQAWIENTDAVAERKVGLIELHPDVFAAQPRV
DIIQENVEWQSKYRYVSMAHTKTRAEVRGGGRKPWPQKGGGRARHGSLRS
PMLKGGGVVHGPRSPTTHFYMLPFYKRVLGLTSTLSVKLAQDDLHIIDNV
DIPTGDAEFLKDLIAERNWGPSVLIVDEDHMFPANICQASDDLGYVNLMP
TFGLNVYSMLKHDTLVLTVAAVKHLEQRLLYQLNRNDAASKGGKFKLDQV
*

LD33485.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:04:40
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL4-PA 296 CG5818-PA 1..296 5..300 1550 100 Plus

LD33485.pep Sequence

Translation from 12 to 902

> LD33485.pep
MLNNILKTSRQVLYPVARTFSRSGNHGNVVTEAAATVGAPPATRSPLILP
QDYTDCLPVSRNTARQAWIENTDAVAERKVGLIELHPDVFAAQPRVDIIQ
ENVEWQSKYRYVSMAHTKTRAEVRGGGRKPWPQKGGGRARHGSLRSPMLK
GGGVVHGPRSPTTHFYMLPFYKRVLGLTSTLSVKLAQDDLHIIDNVDIPT
GDAEFLKDLIAERNWGPSVLIVDEDHMFPANICQASDDLGYVNLMPTFGL
NVYSMLKHDTLVLTVAAVKHLEQRLLYQLNRNDAASKGGKFKLDQV*

LD33485.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 10:03:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15323-PA 296 GF15323-PA 1..296 1..296 1384 86.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 10:03:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24171-PA 296 GG24171-PA 1..296 1..296 1477 95.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 10:03:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11428-PA 923 GH11428-PA 662..923 35..296 1189 80.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:58
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL4-PA 296 CG5818-PA 1..296 1..296 1550 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 10:03:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14673-PA 911 GI14673-PA 640..911 26..296 1188 78.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 10:03:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14082-PA 293 GL14082-PA 1..293 1..296 1265 78.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:03:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19152-PA 293 GA19152-PA 1..293 1..296 1265 78.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 10:03:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17909-PA 296 GM17909-PA 1..296 1..296 1536 96.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 10:03:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21919-PA 296 GD21919-PA 1..296 1..296 1540 96.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 10:03:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17161-PA 298 GJ17161-PA 3..298 4..296 1226 76.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 10:03:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24328-PA 296 GK24328-PA 1..296 1..296 1219 77.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 10:03:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19365-PA 296 GE19365-PA 1..296 1..296 1484 93.2 Plus