Clone LD33652 Report

Search the DGRC for LD33652

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:336
Well:52
Vector:pOT2
Associated Gene/TranscriptAos1-RA
Protein status:LD33652.pep: gold
Preliminary Size:1381
Sequenced Size:1185

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12276 2001-01-01 Release 2 assignment
CG12276 2001-11-29 Blastp of sequenced clone
CG12276 2003-01-01 Sim4 clustering to Release 3
Aos1 2008-04-29 Release 5.5 accounting
Aos1 2008-08-15 Release 5.9 accounting
Aos1 2008-12-18 5.12 accounting

Clone Sequence Records

LD33652.complete Sequence

1185 bp (1185 high quality bases) assembled on 2001-11-29

GenBank Submission: AY069589

> LD33652.complete
TTTCTTGTTGCGGCGTCTCACTGAAAGTTGTTGCAAGAAATTTGTATTAA
GTTGTGAAAAATACATTTTAAACTTGATAAATAAATAATGGTCGTGGATA
TGGACACCAGCGAGACAGCCGTGGAGCTCACTGAGGCGGAGAACGAGCTG
TACGACAGACAAATCCGACTCTGGGGTCTGGAATCTCAGAAACGCCTTCG
CACGGCCAAGATTCTCATCGCTGGACTGTGCGGCCTGGGCGCCGAGATAA
CCAAGAACATCATCCTGTCCGGAGTGAACTCCGTGAAGCTGCTGGATGAC
AAGGACGTAACCGAGGAGGACTTTTGTTCACAATTCCTTGTCCCCCGTGA
ATCGCTGAACACCAACCGGGCCGAAGCATCATTGACACGGGCACGTGCTC
TCAATCCCATGGTGGACATCTCCGCCGACCGCGAGCCCTTGAAGGAGAAG
ACCTCTGAGTTCTTCGGTCAGTTCGACGTTGTGGTGGTCAATGGCGCGAC
CAACGAGGAACTGTTGCGCATTGACACCATTTGCCGGGACCTGGGCGTCA
AGTTCATAGCCACCGATGTGTGGGGCACCTTCGGGTTCTACTTTGCCAGT
CTGCAGAAGCACAGCTACGTCGAGGATGTTATTAAGCACAAGGTCGTAGC
CAATTCGGAGAAGAAAAAGAAGTATGAAACCGTGTCCATTCCAACGCAGC
GTGATGTGGATTATCCCGGCTACTCTGCCTGGCTTGATTTCGATGTTACC
GAGCCTAGTTATTTGCGAAAATTGAAGCGCAATGGCCCGGGTGTTTTGCT
ATTAAGTGTCCTGCAAAAGTTCCGCACAACCCACAAGCGGGATCCCAGCT
ACAAGACCCGAGAAGCTGACCTGGAATTGCTTCGCGGAATTCGCGACGAA
CTGCTGCCCAACTCTATACTGGGCGACGAAGCTCTAGGTCTGATTTTTGC
ACAGATCTCGCCAGCGGTCGCTGTTGTCGGCGGCGTTGTGGCACAAGAGG
TCATCAAGGTGGTTACTAAATTGGAGGCGCCACACCGTAATCTGTTCGTT
TTTGACCCAGAGACTTGTGCCGGATACGTTGAGGCCATCGGAGCGAAGTG
AATTTACCACAAAGGGCTTATTTATAAAAATCTGAATATCAAATAACACC
AGTTGTAAAATTTAAAAAAAAAAAAAAAAAAAAAA

LD33652.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:55:51
Subject Length Description Subject Range Query Range Score Percent Strand
Aos1-RA 1252 Aos1-RA 87..1249 1..1163 5815 100 Plus
Pros25-RA 1076 Pros25-RA 978..1076 1163..1065 495 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:34:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 8257921..8258460 1163..624 2700 100 Minus
chr3R 27901430 chr3R 8258516..8258946 624..194 2155 100 Minus
chr3R 27901430 chr3R 8259013..8259206 194..1 970 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:27:47 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:34:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12432533..12433072 1163..624 2700 100 Minus
3R 32079331 3R 12433128..12433558 624..194 2155 100 Minus
3R 32079331 3R 12433625..12433818 194..1 970 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:21:15
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 12173364..12173903 1163..624 2700 100 Minus
3R 31820162 3R 12173959..12174389 624..194 2155 100 Minus
3R 31820162 3R 12174456..12174649 194..1 970 100 Minus
Blast to na_te.dros performed on 2019-03-16 20:34:20 has no hits.

LD33652.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:35:11 Download gff for LD33652.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 8257921..8258460 624..1163 100 <- Minus
chr3R 8258517..8258945 195..623 100 <- Minus
chr3R 8259013..8259206 1..194 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:15:21 Download gff for LD33652.complete
Subject Subject Range Query Range Percent Splice Strand
Aos1-RA 1..1014 88..1101 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:27:13 Download gff for LD33652.complete
Subject Subject Range Query Range Percent Splice Strand
Aos1-RA 1..1014 88..1101 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:24:18 Download gff for LD33652.complete
Subject Subject Range Query Range Percent Splice Strand
Aos1-RA 1..1014 88..1101 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:54:44 Download gff for LD33652.complete
Subject Subject Range Query Range Percent Splice Strand
Aos1-RA 1..1014 88..1101 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:07:20 Download gff for LD33652.complete
Subject Subject Range Query Range Percent Splice Strand
Aos1-RA 1..1014 88..1101 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:04:00 Download gff for LD33652.complete
Subject Subject Range Query Range Percent Splice Strand
Aos1-RA 87..1249 1..1163 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:27:13 Download gff for LD33652.complete
Subject Subject Range Query Range Percent Splice Strand
Aos1-RA 87..1249 1..1163 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:24:18 Download gff for LD33652.complete
Subject Subject Range Query Range Percent Splice Strand
Aos1-RA 5..1167 1..1163 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:54:44 Download gff for LD33652.complete
Subject Subject Range Query Range Percent Splice Strand
Aos1-RA 87..1249 1..1163 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:07:20 Download gff for LD33652.complete
Subject Subject Range Query Range Percent Splice Strand
Aos1-RA 5..1167 1..1163 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:35:11 Download gff for LD33652.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12432533..12433072 624..1163 100 <- Minus
3R 12433129..12433557 195..623 100 <- Minus
3R 12433625..12433818 1..194 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:35:11 Download gff for LD33652.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12432533..12433072 624..1163 100 <- Minus
3R 12433129..12433557 195..623 100 <- Minus
3R 12433625..12433818 1..194 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:35:11 Download gff for LD33652.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12432533..12433072 624..1163 100 <- Minus
3R 12433129..12433557 195..623 100 <- Minus
3R 12433625..12433818 1..194 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:24:18 Download gff for LD33652.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8258255..8258794 624..1163 100 <- Minus
arm_3R 8258851..8259279 195..623 100 <- Minus
arm_3R 8259347..8259540 1..194 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:30:48 Download gff for LD33652.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12173364..12173903 624..1163 100 <- Minus
3R 12173960..12174388 195..623 100 <- Minus
3R 12174456..12174649 1..194 100   Minus

LD33652.pep Sequence

Translation from 87 to 1100

> LD33652.pep
MVVDMDTSETAVELTEAENELYDRQIRLWGLESQKRLRTAKILIAGLCGL
GAEITKNIILSGVNSVKLLDDKDVTEEDFCSQFLVPRESLNTNRAEASLT
RARALNPMVDISADREPLKEKTSEFFGQFDVVVVNGATNEELLRIDTICR
DLGVKFIATDVWGTFGFYFASLQKHSYVEDVIKHKVVANSEKKKKYETVS
IPTQRDVDYPGYSAWLDFDVTEPSYLRKLKRNGPGVLLLSVLQKFRTTHK
RDPSYKTREADLELLRGIRDELLPNSILGDEALGLIFAQISPAVAVVGGV
VAQEVIKVVTKLEAPHRNLFVFDPETCAGYVEAIGAK*

LD33652.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 10:22:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17042-PA 339 GF17042-PA 1..338 1..336 1404 77.8 Plus
Dana\GF11487-PA 1191 GF11487-PA 201..357 21..180 196 34.4 Plus
Dana\GF23890-PA 524 GF23890-PA 18..178 22..179 178 28 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 10:22:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17124-PA 337 GG17124-PA 1..337 1..337 1635 92.9 Plus
Dere\GG15477-PA 524 GG15477-PA 18..178 22..179 190 28.6 Plus
Dere\GG25268-PA 1189 GG25268-PA 197..345 21..172 186 36.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 10:22:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23591-PA 337 GH23591-PA 1..337 1..337 1314 74.2 Plus
Dgri\GH22854-PA 1244 GH22854-PA 251..402 18..172 194 35.5 Plus
Dgri\GH15185-PA 519 GH15185-PA 19..173 22..179 158 28.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:29:25
Subject Length Description Subject Range Query Range Score Percent Strand
Aos1-PA 337 CG12276-PA 1..337 1..337 1710 100 Plus
Uba1-PC 1008 CG1782-PC 11..172 16..180 226 33.9 Plus
Uba1-PA 1191 CG1782-PA 194..355 16..180 226 33.9 Plus
APP-BP1-PA 524 CG7828-PA 14..178 18..179 188 29.9 Plus
APP-BP1-PB 524 CG7828-PB 14..178 18..179 188 29.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 10:22:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10362-PA 337 GI10362-PA 1..335 1..335 1323 75.5 Plus
Dmoj\GI12125-PA 525 GI12125-PA 19..179 22..179 179 28.8 Plus
Dmoj\GI21231-PA 1198 GI21231-PA 205..364 18..180 172 33.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 10:22:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27174-PA 340 GL27174-PA 8..338 6..335 1301 75.2 Plus
Dper\GL17327-PA 502 GL17327-PA 193..339 21..170 191 36.7 Plus
Dper\GL25218-PA 524 GL25218-PA 18..178 22..179 182 30.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:22:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11527-PA 340 GA11527-PA 8..338 6..335 1299 74.9 Plus
Dpse\GA14681-PA 1184 GA14681-PA 190..341 18..172 190 35.5 Plus
Dpse\GA20612-PA 524 GA20612-PA 18..178 22..179 182 30.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 10:22:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26007-PA 337 GM26007-PA 1..337 1..337 1741 97.6 Plus
Dsec\GM20586-PA 1191 GM20586-PA 199..347 21..172 188 36.2 Plus
Dsec\GM25249-PA 524 GM25249-PA 18..178 22..179 187 28.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 10:22:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20565-PA 337 GD20565-PA 1..337 1..337 1744 97.6 Plus
Dsim\GD14283-PA 524 GD14283-PA 18..178 22..179 193 29.2 Plus
Dsim\GD10057-PA 1191 GD10057-PA 199..347 21..172 189 36.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 10:22:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22581-PA 337 GJ22581-PA 1..335 1..335 1370 79.1 Plus
Dvir\GJ13397-PA 519 GJ13397-PA 19..173 22..179 186 30.7 Plus
Dvir\GJ20835-PA 1230 GJ20835-PA 237..388 18..172 178 34.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 10:22:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12842-PA 342 GK12842-PA 1..340 1..335 1334 73.5 Plus
Dwil\GK12324-PA 498 GK12324-PA 18..178 22..179 187 28.8 Plus
Dwil\GK15620-PA 1209 GK15620-PA 215..374 18..180 185 33.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 10:22:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24516-PA 337 GE24516-PA 1..337 1..337 1630 93.2 Plus
Dyak\GE22126-PA 1189 GE22126-PA 197..345 21..172 191 36.2 Plus
Dyak\GE21787-PA 524 GE21787-PA 18..178 22..179 186 28 Plus

LD33652.hyp Sequence

Translation from 87 to 1100

> LD33652.hyp
MVVDMDTSETAVELTEAENELYDRQIRLWGLESQKRLRTAKILIAGLCGL
GAEITKNIILSGVNSVKLLDDKDVTEEDFCSQFLVPRESLNTNRAEASLT
RARALNPMVDISADREPLKEKTSEFFGQFDVVVVNGATNEELLRIDTICR
DLGVKFIATDVWGTFGFYFASLQKHSYVEDVIKHKVVANSEKKKKYETVS
IPTQRDVDYPGYSAWLDFDVTEPSYLRKLKRNGPGVLLLSVLQKFRTTHK
RDPSYKTREADLELLRGIRDELLPNSILGDEALGLIFAQISPAVAVVGGV
VAQEVIKVVTKLEAPHRNLFVFDPETCAGYVEAIGAK*

LD33652.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:00:26
Subject Length Description Subject Range Query Range Score Percent Strand
Aos1-PA 337 CG12276-PA 1..337 1..337 1710 100 Plus
Uba1-PC 1008 CG1782-PC 11..172 16..180 226 33.9 Plus
Uba1-PA 1191 CG1782-PA 194..355 16..180 226 33.9 Plus
APP-BP1-PA 524 CG7828-PA 14..178 18..179 188 29.9 Plus
APP-BP1-PB 524 CG7828-PB 14..178 18..179 188 29.9 Plus