Clone LD33759 Report

Search the DGRC for LD33759

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:337
Well:59
Vector:pOT2
Associated Gene/TranscriptArp10-RA
Protein status:LD33759.pep: gold
Preliminary Size:1585
Sequenced Size:1374

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12235 2001-01-01 Release 2 assignment
CG12235 2001-07-04 Blastp of sequenced clone
CG12235 2003-01-01 Sim4 clustering to Release 3
Arp11 2008-04-29 Release 5.5 accounting
Arp11 2008-08-15 Release 5.9 accounting
Arp11 2008-12-18 5.12 accounting

Clone Sequence Records

LD33759.complete Sequence

1374 bp (1374 high quality bases) assembled on 2001-07-04

GenBank Submission: AY051833

> LD33759.complete
CGAACTGAACAATATACCATTCCATGGTCTAGTCGGTTCGTCCAGCAAAG
GAGCAAGCAGCCAGCAGACAGCAGCCAAGATGCCCATTTACGAGAGCGTG
ATGCAGGAGAAGCCGCCCATTGTCCTCGACATTGGCACCGCCTACACCAA
GCTGGGATTCGCAGCGGAGGCGTATCCGCGCAAGATCATGCCCACGGAGG
TGGTGATGACCACGACGGGGATCCGGAAGCGTCTGTTCGACTACGACACT
CCGGAGGAGCTGTACGACCAGCTAGTGGATTTTCTGCAGACGATCTTCTT
CAAGCATCTACTGGTCAGCCCCAAGGAGCGCAAGTTCGTGCTGGTGGAGA
ACGTGTTCGGATCCACTGTGCTGCGTGAAACCTTGGCCCGCGTGCTCTTT
GTCCACTTCGACGTCTCCTCCGTGCTGTTCGTGCCCGTGCATCTCATTGC
GCTGTCTACGCTGGCAGTGCCCACTGCCCTTGTGGTGGACGTTGGCTACA
GCGAGACCAGCGTTATGCCCGTCTTCAGCGGGGTGCAAATCATGGCCGCC
TTCAAGGATCAGAGCTACGGAGGCAGCGCCATCCACGCGGAGATCAAGCG
GCAGCTGGTTGAGAGTGGCGTTAAGGAGAGCCTGCTAACAGAAAGCGTGC
TGGAGGACATCAAGGTGCGAACCTGCTTTGTGACCACCATGGAAAGAGCC
AAGGCCCGCGCCAACGGCGACGAGAATCAGCCGACTCCCGCGCCAGACGT
GGACTACATTGTCAGCGACAACGATGCGGTCATCCAGGTGCCCGGCCTCC
TGCGGGAGTCTGCCTACGAGATCATGTTCGAGGCCAGCAACGAGCGGGAC
AGCCTGCCGCATCTCATCCTGCGCTCCATTCTCGACTGCACACTAGACGT
GCGACGTGCCCTGGTCGAGAGTGTGTTCCTCGTGGGCGGCGGCTCAATGG
TCCAGGGTCTGCTGGCCCGCCTCCGCCAGGAGCTGCAGCATCTGCTCACC
GAGGATCCGTTCTACGCCGAACGCTTCCATGGCGAGCTGCAGTTCAAGTT
TTTCAATGCTGTCGGCAAGCAAAACTTTACTGCCTGGCTGGGCGGCGCCT
TGTGCGGCGCGACGGATCTCATCCAGACACGATCGCTGGTCAAGGAGACG
TATCTAAAGAGCGAGCACGTTCCCGACTGGAGCAACCTGTGCGATAATAG
GCCGACAGGCTCGTAGACTCGAGGGCAGTCCCGGAAGATGGAAATATGTA
CGCTTCGGCGCTTTACTGGTTACGCGTACTAACATACTCTTGATTATTAT
TCTGTAATATATAGGTATTAAATATTTACGAAATATAGGCTAACGAGCTT
TAAACAAAAAAAAAAAAAAAAAAA

LD33759.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:30:36
Subject Length Description Subject Range Query Range Score Percent Strand
Arp11-RA 1563 Arp11-RA 204..1562 1..1359 6795 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:03:33
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 19533323..19534374 1355..304 5215 99.7 Minus
chrX 22417052 chrX 19534424..19534577 304..151 770 100 Minus
chrX 22417052 chrX 19534637..19534787 151..1 725 98.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:28:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:03:31
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19644527..19645582 1359..304 5280 100 Minus
X 23542271 X 19645632..19645785 304..151 770 100 Minus
X 23542271 X 19645845..19645995 151..1 755 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:52:50
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 19652625..19653680 1359..304 5280 100 Minus
X 23527363 X 19653730..19653883 304..151 770 100 Minus
X 23527363 X 19653943..19654093 151..1 755 100 Minus
Blast to na_te.dros performed on 2019-03-15 16:03:32 has no hits.

LD33759.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:04:42 Download gff for LD33759.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 19533323..19534374 304..1355 99 <- Minus
chrX 19534425..19534577 151..303 100 <- Minus
chrX 19534638..19534787 1..150 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:15:34 Download gff for LD33759.complete
Subject Subject Range Query Range Percent Splice Strand
Arp11-RA 1..1137 80..1216 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:18:52 Download gff for LD33759.complete
Subject Subject Range Query Range Percent Splice Strand
Arp11-RA 1..1137 80..1216 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:50:54 Download gff for LD33759.complete
Subject Subject Range Query Range Percent Splice Strand
Arp10-RA 1..1137 80..1216 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:50:28 Download gff for LD33759.complete
Subject Subject Range Query Range Percent Splice Strand
Arp11-RA 1..1137 80..1216 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:25:05 Download gff for LD33759.complete
Subject Subject Range Query Range Percent Splice Strand
Arp10-RA 1..1137 80..1216 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:14:22 Download gff for LD33759.complete
Subject Subject Range Query Range Percent Splice Strand
Arp11-RA 52..1406 1..1355 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:18:52 Download gff for LD33759.complete
Subject Subject Range Query Range Percent Splice Strand
Arp11-RA 52..1406 1..1355 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:50:54 Download gff for LD33759.complete
Subject Subject Range Query Range Percent Splice Strand
Arp10-RA 20..1374 1..1355 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:50:28 Download gff for LD33759.complete
Subject Subject Range Query Range Percent Splice Strand
Arp11-RA 52..1406 1..1355 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:25:05 Download gff for LD33759.complete
Subject Subject Range Query Range Percent Splice Strand
Arp10-RA 20..1374 1..1355 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:04:42 Download gff for LD33759.complete
Subject Subject Range Query Range Percent Splice Strand
X 19645633..19645785 151..303 100 <- Minus
X 19645846..19645995 1..150 100   Minus
X 19644531..19645582 304..1355 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:04:42 Download gff for LD33759.complete
Subject Subject Range Query Range Percent Splice Strand
X 19645633..19645785 151..303 100 <- Minus
X 19645846..19645995 1..150 100   Minus
X 19644531..19645582 304..1355 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:04:42 Download gff for LD33759.complete
Subject Subject Range Query Range Percent Splice Strand
X 19645633..19645785 151..303 100 <- Minus
X 19645846..19645995 1..150 100   Minus
X 19644531..19645582 304..1355 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:50:54 Download gff for LD33759.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 19538564..19539615 304..1355 100 <- Minus
arm_X 19539666..19539818 151..303 100 <- Minus
arm_X 19539879..19540028 1..150 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:28:46 Download gff for LD33759.complete
Subject Subject Range Query Range Percent Splice Strand
X 19652629..19653680 304..1355 100 <- Minus
X 19653731..19653883 151..303 100 <- Minus
X 19653944..19654093 1..150 100   Minus

LD33759.hyp Sequence

Translation from 0 to 1215

> LD33759.hyp
ELNNIPFHGLVGSSSKGASSQQTAAKMPIYESVMQEKPPIVLDIGTAYTK
LGFAAEAYPRKIMPTEVVMTTTGIRKRLFDYDTPEELYDQLVDFLQTIFF
KHLLVSPKERKFVLVENVFGSTVLRETLARVLFVHFDVSSVLFVPVHLIA
LSTLAVPTALVVDVGYSETSVMPVFSGVQIMAAFKDQSYGGSAIHAEIKR
QLVESGVKESLLTESVLEDIKVRTCFVTTMERAKARANGDENQPTPAPDV
DYIVSDNDAVIQVPGLLRESAYEIMFEASNERDSLPHLILRSILDCTLDV
RRALVESVFLVGGGSMVQGLLARLRQELQHLLTEDPFYAERFHGELQFKF
FNAVGKQNFTAWLGGALCGATDLIQTRSLVKETYLKSEHVPDWSNLCDNR
PTGS*

LD33759.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:10:35
Subject Length Description Subject Range Query Range Score Percent Strand
Arp10-PB 378 CG12235-PB 1..378 27..404 1921 100 Plus
Arp10-PA 378 CG12235-PA 1..378 27..404 1921 100 Plus
Act57B-PA 376 CG10067-PA 5..366 36..387 212 21.9 Plus
Act87E-PC 376 CG18290-PC 5..366 36..387 210 21.6 Plus
Act87E-PB 376 CG18290-PB 5..366 36..387 210 21.6 Plus

LD33759.pep Sequence

Translation from 79 to 1215

> LD33759.pep
MPIYESVMQEKPPIVLDIGTAYTKLGFAAEAYPRKIMPTEVVMTTTGIRK
RLFDYDTPEELYDQLVDFLQTIFFKHLLVSPKERKFVLVENVFGSTVLRE
TLARVLFVHFDVSSVLFVPVHLIALSTLAVPTALVVDVGYSETSVMPVFS
GVQIMAAFKDQSYGGSAIHAEIKRQLVESGVKESLLTESVLEDIKVRTCF
VTTMERAKARANGDENQPTPAPDVDYIVSDNDAVIQVPGLLRESAYEIMF
EASNERDSLPHLILRSILDCTLDVRRALVESVFLVGGGSMVQGLLARLRQ
ELQHLLTEDPFYAERFHGELQFKFFNAVGKQNFTAWLGGALCGATDLIQT
RSLVKETYLKSEHVPDWSNLCDNRPTGS*

LD33759.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 15:06:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20417-PA 382 GF20417-PA 1..382 1..378 1630 79.3 Plus
Dana\GF12208-PA 376 GF12208-PA 9..366 14..361 219 22.1 Plus
Dana\GF10940-PA 376 GF10940-PA 4..366 9..361 217 22 Plus
Dana\GF17602-PA 376 GF17602-PA 9..366 14..361 216 21.3 Plus
Dana\GF18300-PA 376 GF18300-PA 9..366 14..361 214 22.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 15:06:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18038-PA 378 GG18038-PA 1..378 1..378 1944 96.6 Plus
Dere\GG22068-PA 376 GG22068-PA 9..366 14..361 219 22.1 Plus
Dere\GG16241-PA 376 GG16241-PA 4..366 9..361 217 22 Plus
Dere\GG19688-PA 376 GG19688-PA 9..366 14..361 216 21.3 Plus
Dere\GG16929-PA 376 GG16929-PA 9..366 14..361 214 22.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 15:06:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12098-PA 374 GH12098-PA 1..374 1..377 1623 77.5 Plus
Dgri\GH22007-PA 376 GH22007-PA 9..366 14..361 219 22.1 Plus
Dgri\GH14437-PA 376 GH14437-PA 4..366 9..361 217 22 Plus
Dgri\GH19077-PA 376 GH19077-PA 9..366 14..361 217 22.1 Plus
Dgri\GH19045-PA 376 GH19045-PA 9..366 14..361 216 21.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:53:06
Subject Length Description Subject Range Query Range Score Percent Strand
Arp10-PB 378 CG12235-PB 1..378 1..378 1921 100 Plus
Arp10-PA 378 CG12235-PA 1..378 1..378 1921 100 Plus
Act57B-PA 376 CG10067-PA 5..366 10..361 212 21.9 Plus
Act87E-PC 376 CG18290-PC 5..366 10..361 210 21.6 Plus
Act87E-PB 376 CG18290-PB 5..366 10..361 210 21.6 Plus
Act87E-PA 376 CG18290-PA 5..366 10..361 210 21.6 Plus
Act79B-PB 376 CG7478-PB 4..366 9..361 209 21.6 Plus
Act79B-PA 376 CG7478-PA 4..366 9..361 209 21.6 Plus
Act5C-PE 376 CG4027-PE 4..366 9..361 206 21.4 Plus
Act5C-PD 376 CG4027-PD 4..366 9..361 206 21.4 Plus
Act5C-PC 376 CG4027-PC 4..366 9..361 206 21.4 Plus
Act5C-PA 376 CG4027-PA 4..366 9..361 206 21.4 Plus
Act5C-PB 376 CG4027-PB 4..366 9..361 206 21.4 Plus
Arp3-PB 418 CG7558-PB 6..387 12..345 206 25.9 Plus
Arp3-PA 418 CG7558-PA 6..387 12..345 206 25.9 Plus
Act42A-PA 376 CG12051-PA 4..366 9..361 205 21.6 Plus
Act88F-PA 376 CG5178-PA 9..366 14..361 205 21.7 Plus
Arp6-PA 398 CG11678-PA 6..349 14..309 176 22.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 15:06:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11103-PA 371 GI11103-PA 1..371 1..377 1581 76.4 Plus
Dmoj\GI19711-PA 376 GI19711-PA 9..366 14..361 219 22.1 Plus
Dmoj\GI13569-PA 376 GI13569-PA 4..366 9..361 217 22 Plus
Dmoj\GI23222-PA 376 GI23222-PA 9..366 14..361 217 22.1 Plus
Dmoj\GI24339-PA 376 GI24339-PA 9..366 14..361 216 21.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 15:06:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27098-PA 378 GL27098-PA 1..378 1..378 1766 84.7 Plus
Dper\GL15751-PA 379 GL15751-PA 4..366 14..358 232 23.4 Plus
Dper\GL17061-PA 376 GL17061-PA 9..366 14..361 219 22.1 Plus
Dper\GL14888-PA 376 GL14888-PA 4..366 9..361 213 21.3 Plus
Dper\GL17787-PA 376 GL17787-PA 4..366 9..361 211 21.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 15:06:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11497-PA 378 GA11497-PA 1..378 1..378 1760 84.4 Plus
Dpse\GA26082-PA 379 GA26082-PA 4..366 14..358 232 23.7 Plus
Dpse\GA24346-PA 376 GA24346-PA 9..366 14..361 219 22.1 Plus
Dpse\GA20380-PA 376 GA20380-PA 4..366 9..361 217 22 Plus
Dpse\GA14877-PB 376 GA14877-PB 9..366 14..361 216 21.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 15:06:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22722-PA 285 GM22722-PA 76..285 143..378 914 75 Plus
Dsec\GM22722-PA 285 GM22722-PA 1..57 1..57 299 98.2 Plus
Dsec\GM22426-PA 376 GM22426-PA 4..366 9..361 217 22 Plus
Dsec\GM12447-PA 376 GM12447-PA 4..366 9..361 213 21.3 Plus
Dsec\GM16492-PA 376 GM16492-PA 4..366 9..361 211 21.3 Plus
Dsec\GM24109-PA 376 GM24109-PA 9..366 14..361 203 21.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 15:06:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24454-PA 378 GD24454-PA 1..378 1..378 1966 98.1 Plus
Dsim\GD11548-PA 376 GD11548-PA 9..366 14..361 219 22.1 Plus
Dsim\GD15015-PA 376 GD15015-PA 4..366 9..361 217 22 Plus
Dsim\GD18909-PA 376 GD18909-PA 9..366 14..361 216 21.3 Plus
Dsim\Act88F-PA 376 GD19025-PA 9..366 14..361 214 22.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 15:06:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15957-PA 378 GJ15957-PA 1..378 1..377 1564 77.2 Plus
Dvir\ActC2-PA 376 GJ17479-PA 9..366 14..361 219 22.1 Plus
Dvir\ActD1-PA 376 GJ13903-PA 4..366 9..361 217 22 Plus
Dvir\ActE2-PA 376 GJ22881-PA 9..366 14..361 217 22.1 Plus
Dvir\ActE1-PA 376 GJ10425-PA 9..366 14..361 216 21.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 15:06:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19852-PA 383 GK19852-PA 1..383 1..378 1570 75.2 Plus
Dwil\GK23336-PA 376 GK23336-PA 9..366 14..361 219 22.1 Plus
Dwil\GK10683-PA 376 GK10683-PA 4..366 9..361 217 22 Plus
Dwil\GK13943-PA 376 GK13943-PA 9..366 14..361 216 21.3 Plus
Dwil\GK11462-PA 376 GK11462-PA 9..366 14..361 214 22.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 15:06:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17367-PA 378 GE17367-PA 1..378 1..378 1959 97.1 Plus
Dyak\GE12149-PA 376 GE12149-PA 9..366 14..361 219 22.1 Plus
Dyak\GE26273-PA 376 GE26273-PA 9..366 14..361 216 21.3 Plus
Dyak\GE24312-PA 376 GE24312-PA 9..366 14..361 214 22.1 Plus
Dyak\Act57B-PA 376 GE17558-PA 4..366 9..361 213 21.3 Plus