Clone LD33828 Report

Search the DGRC for LD33828

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:338
Well:28
Vector:pOT2
Associated Gene/TranscriptCG3887-RA
Protein status:LD33828.pep: gold
Preliminary Size:1141
Sequenced Size:957

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3887 2001-01-01 Release 2 assignment
CG3887 2001-10-10 Blastp of sequenced clone
CG3887 2003-01-01 Sim4 clustering to Release 3
CG3887 2008-04-29 Release 5.5 accounting
CG3887 2008-08-15 Release 5.9 accounting
CG3887 2008-12-18 5.12 accounting

Clone Sequence Records

LD33828.complete Sequence

957 bp (957 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061409

> LD33828.complete
CAAACACCAAGGCAAAAGTGTGAGGAAATATTGAATTCCAAATTAAATTC
CTAATTAAATCAGACCATAAGCACGCAATGGAAAGGCTGACCGGAAGGAA
TGTGGCACTACTGGTGCTGTGCCTGTGCGCCGGATACGCCCTGGTGTTCG
CCGAGGGCGAGAAGGAGATACCGGTTACCAAATTCGGACAGAACATAGCG
CCGACGATGACTTTCCTTTACTGCTACTCCTGCGGCTATCGCAAGGCGTT
CGAGGACTACGTGGGCCTGCTGGGCGAGAAGTATCCGCAAATTCAGGTGA
ATGGCGGCAACTACGATCCGCCGGGTCTAAACTATTACCTCTCCAAGATG
ATATTCGCCCTGAAGATCATAATCATTGTGTCCGTGGTCAGTGCGGTCAG
TCCGTTCACCTTCCTTGGCCTGAACACGCCCAGTTGGTGGAGCCACATGC
AGGCTAACAAGATATACGCCTGCATGATGATCTTCTTCCTGGGCAACATG
CTCGAGGCCCAGCTCATCTCGTCCGGCGCTTTCGAGATAACACTAAACGA
TGTGCCTGTGTGGTCGAAACTGCAGACGGGACGCTTTCCCTCGCCGGAGG
TACTCTTTCAAATCATCGACAACCATCTGCAGTTCACCGAAAAGGTGCAG
GAGAATCCGGACTTTGTTAAATAATAGCATTGGACTGACTGGACGGACGG
AGGAGCGCGGAAAACAGCAGTTGGACAACACCAAAACAGCCGCAGACATC
GATTTCCGGCTCTGAACCTAACTTAAACATAAGCTCTTGTCCCGACATTA
TCCACTTAGCTGTATTTCTGTTTTCACCCCAACTATAGCCTACTCTACAC
ATCCTAAACGCATCCAATCCGAACCGAACAAAATCGCATTTGATCGGATT
TAGATGGGATATAAAGTTCGCTTTAATTTCAATCAAACGAAAAAAAAAAA
AAAAAAA

LD33828.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:15:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG3887-RA 1243 CG3887-RA 234..1175 1..942 4710 100 Plus
CG3887.b 1081 CG3887.b 206..1081 64..939 4380 100 Plus
CG3887.c 1073 CG3887.c 206..1073 72..939 4340 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:47:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 5010511..5011227 223..939 3585 100 Plus
chr2L 23010047 chr2L 5010213..5010435 1..223 1115 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:28:05 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:47:33
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5011411..5012130 223..942 3600 100 Plus
2L 23513712 2L 5011113..5011335 1..223 1115 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:38:40
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5011411..5012130 223..942 3600 100 Plus
2L 23513712 2L 5011113..5011335 1..223 1115 100 Plus
Blast to na_te.dros performed on 2019-03-16 02:47:34 has no hits.

LD33828.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:48:44 Download gff for LD33828.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 5010213..5010435 1..223 100 -> Plus
chr2L 5010512..5011227 224..939 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:15:39 Download gff for LD33828.complete
Subject Subject Range Query Range Percent Splice Strand
CG3887-RA 1..597 78..674 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:56:11 Download gff for LD33828.complete
Subject Subject Range Query Range Percent Splice Strand
CG3887-RA 1..597 78..674 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:37:18 Download gff for LD33828.complete
Subject Subject Range Query Range Percent Splice Strand
CG3887-RA 1..597 78..674 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:25:23 Download gff for LD33828.complete
Subject Subject Range Query Range Percent Splice Strand
CG3887-RA 1..597 78..674 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:21:06 Download gff for LD33828.complete
Subject Subject Range Query Range Percent Splice Strand
CG3887-RA 1..597 78..674 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:42:09 Download gff for LD33828.complete
Subject Subject Range Query Range Percent Splice Strand
CG3887-RA 1..939 1..939 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:56:11 Download gff for LD33828.complete
Subject Subject Range Query Range Percent Splice Strand
CG3887-RA 33..971 1..939 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:37:18 Download gff for LD33828.complete
Subject Subject Range Query Range Percent Splice Strand
CG3887-RA 22..960 1..939 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:25:23 Download gff for LD33828.complete
Subject Subject Range Query Range Percent Splice Strand
CG3887-RA 1..939 1..939 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:21:06 Download gff for LD33828.complete
Subject Subject Range Query Range Percent Splice Strand
CG3887-RA 22..960 1..939 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:48:44 Download gff for LD33828.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5011113..5011335 1..223 100 -> Plus
2L 5011412..5012127 224..939 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:48:44 Download gff for LD33828.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5011113..5011335 1..223 100 -> Plus
2L 5011412..5012127 224..939 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:48:44 Download gff for LD33828.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5011113..5011335 1..223 100 -> Plus
2L 5011412..5012127 224..939 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:37:18 Download gff for LD33828.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5011113..5011335 1..223 100 -> Plus
arm_2L 5011412..5012127 224..939 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:02:32 Download gff for LD33828.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5011113..5011335 1..223 100 -> Plus
2L 5011412..5012127 224..939 100   Plus

LD33828.pep Sequence

Translation from 77 to 673

> LD33828.pep
MERLTGRNVALLVLCLCAGYALVFAEGEKEIPVTKFGQNIAPTMTFLYCY
SCGYRKAFEDYVGLLGEKYPQIQVNGGNYDPPGLNYYLSKMIFALKIIII
VSVVSAVSPFTFLGLNTPSWWSHMQANKIYACMMIFFLGNMLEAQLISSG
AFEITLNDVPVWSKLQTGRFPSPEVLFQIIDNHLQFTEKVQENPDFVK*

LD33828.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 10:03:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15710-PA 198 GF15710-PA 1..198 1..198 967 89.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 10:03:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25041-PA 198 GG25041-PA 1..198 1..198 1009 94.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 10:03:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11481-PA 196 GH11481-PA 1..196 1..198 905 84.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:37:20
Subject Length Description Subject Range Query Range Score Percent Strand
SelT-PC 198 CG3887-PC 1..198 1..198 1047 100 Plus
SelT-PB 198 CG3887-PB 1..198 1..198 1047 100 Plus
SelT-PA 198 CG3887-PA 1..198 1..198 1047 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 10:03:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16976-PA 196 GI16976-PA 1..196 1..198 731 81.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 10:03:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26542-PA 197 GL26542-PA 1..197 1..198 859 85.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:03:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17753-PA 197 GA17753-PA 1..197 1..198 859 85.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 10:03:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18515-PA 198 GM18515-PA 1..198 1..198 1041 98 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 10:03:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17222-PA 197 GJ17222-PA 1..197 1..198 850 83.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 10:03:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24855-PA 200 GK24855-PA 1..200 1..198 810 85.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 10:03:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11298-PA 198 GE11298-PA 1..198 1..198 1024 96.5 Plus

LD33828.hyp Sequence

Translation from 77 to 673

> LD33828.hyp
MERLTGRNVALLVLCLCAGYALVFAEGEKEIPVTKFGQNIAPTMTFLYCY
SCGYRKAFEDYVGLLGEKYPQIQVNGGNYDPPGLNYYLSKMIFALKIIII
VSVVSAVSPFTFLGLNTPSWWSHMQANKIYACMMIFFLGNMLEAQLISSG
AFEITLNDVPVWSKLQTGRFPSPEVLFQIIDNHLQFTEKVQENPDFVK*

LD33828.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:34:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG3887-PC 198 CG3887-PC 1..198 1..198 1047 100 Plus
CG3887-PB 198 CG3887-PB 1..198 1..198 1047 100 Plus
CG3887-PA 198 CG3887-PA 1..198 1..198 1047 100 Plus