LD34214.complete Sequence
816 bp (816 high quality bases) assembled on 2001-10-10
GenBank Submission: AY061411
> LD34214.complete
ATAAATTAGCGAAATTTTAATTTGATTTCCTTCGCAAATTTCCGCCGAAC
TCGACTGTGGATTGGATGTGGACTGGATGTGGCCGGGTGTCGGAGTGTCT
GGCCAAGTGGACACAGAAGCCGAGGCAGCAAATAAACTAAGTGAATTTAT
GGCCCCAGGGCAGGAGCGGCACACGTGTGCGACATGCCCACACATTGACA
CCTACCAATAACCAACTATCAAGTACCGGCCATCCAATAAACGAACTAAC
CACATACTCCACACACACCACACTCCAATTGGGCTGCAGGTCCCTGGGCG
CGTTTTGGATCAGATCGTCTTGGTTCGGTTTTGGTTGGATGTTTTGTTTA
TGCTGGGCAGGCACAAACGAGCTGACAATGCCCCATGTCGTGGCGACGGT
ACGTGCGGCCAAACAAATTACAGGGAAATTGCGTCACCTGCAGGAATTTC
CACTCGACATTGTCAAATGCCATCAGAAATCGCTGGACATGTTGTAACAT
TAATTTGACATTTTACGGCCCAGGACGGGGATCGTCGACGGGAATGAGAC
CGCAGAGCAACGCAGGACAACGTTAAATCCACCAGCAGACAGCTGTCGAG
ATGACCAAAGATGCTGGAGCCACCAAGGGATCTTGCAGCAGCATCTCGGT
CACTCGGAAAAGTATGAGATACACTGAGAACACGGTCTACGAAGGAAGCA
CACAACTGTGGCAAGGATTGCTGAAGGATTCGCTTTCATGGCTATACACA
TACGAACGATGATGCTGTAAATATGAATAAAATATATATATAAATGAAAA
AAAAAAAAAAAAAAAA
LD34214.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 20:15:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31517-RA | 1007 | CG31517-RA | 194..991 | 1..798 | 3990 | 100 | Plus |
CG31517.a | 1314 | CG31517.a | 107..904 | 1..798 | 3990 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:02:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 9773361..9773908 | 1..548 | 2740 | 100 | Plus |
chr3R | 27901430 | chr3R | 9773991..9774240 | 547..796 | 1250 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:28:34 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:02:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 13948451..13948998 | 1..548 | 2740 | 100 | Plus |
3R | 32079331 | 3R | 13949081..13949332 | 547..798 | 1260 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:38:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 13689282..13689829 | 1..548 | 2740 | 100 | Plus |
3R | 31820162 | 3R | 13689912..13690163 | 547..798 | 1260 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 22:02:50 has no hits.
LD34214.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:03:36 Download gff for
LD34214.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 9773361..9773908 | 1..548 | 100 | -> | Plus |
chr3R | 9773993..9774208 | 549..764 | 100 | <- | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:16:10 Download gff for
LD34214.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31517-RA | 1..192 | 385..576 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:56:13 Download gff for
LD34214.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31517-RA | 1..192 | 385..576 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:08:29 Download gff for
LD34214.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31517-RA | 1..192 | 385..576 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:25:24 Download gff for
LD34214.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31517-RA | 1..192 | 385..576 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:30:53 Download gff for
LD34214.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31517-RA | 1..192 | 385..576 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:42:11 Download gff for
LD34214.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31517-RA | 17..812 | 1..796 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:56:12 Download gff for
LD34214.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31517-RA | 17..812 | 1..796 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:08:29 Download gff for
LD34214.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31517-RA | 17..812 | 1..796 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:25:25 Download gff for
LD34214.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31517-RA | 17..812 | 1..796 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:30:53 Download gff for
LD34214.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31517-RA | 32..827 | 1..796 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:03:36 Download gff for
LD34214.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 13948451..13948998 | 1..548 | 100 | -> | Plus |
3R | 13949083..13949330 | 549..796 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:03:36 Download gff for
LD34214.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 13948451..13948998 | 1..548 | 100 | -> | Plus |
3R | 13949083..13949330 | 549..796 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:03:36 Download gff for
LD34214.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 13948451..13948998 | 1..548 | 100 | -> | Plus |
3R | 13949083..13949330 | 549..796 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:08:29 Download gff for
LD34214.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 9774173..9774720 | 1..548 | 100 | -> | Plus |
arm_3R | 9774805..9775052 | 549..796 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:02:33 Download gff for
LD34214.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 13689282..13689829 | 1..548 | 100 | -> | Plus |
3R | 13689914..13690161 | 549..796 | 100 | | Plus |
LD34214.pep Sequence
Translation from 384 to 575
> LD34214.pep
MSWRRYVRPNKLQGNCVTCRNFHSTLSNAIRNRWTCCNINLTFYGPGRGS
STGMRPQSNAGQR*
LD34214.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 10:01:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG19884-PA | 97 | GG19884-PA | 1..62 | 1..63 | 288 | 88.9 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:47:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31517-PB | 63 | CG31517-PB | 1..63 | 1..63 | 357 | 100 | Plus |
CG31517-PA | 63 | CG31517-PA | 1..63 | 1..63 | 357 | 100 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 10:01:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL24226-PA | 180 | GL24226-PA | 10..54 | 6..50 | 207 | 84.4 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:01:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA16294-PA | 76 | GA16294-PA | 10..67 | 6..63 | 216 | 69 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 10:01:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM24142-PA | 63 | GM24142-PA | 1..63 | 1..63 | 314 | 93.7 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 10:01:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD18938-PA | 63 | GD18938-PA | 1..63 | 1..63 | 318 | 95.2 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 10:01:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE26305-PA | 131 | GE26305-PA | 1..62 | 1..63 | 288 | 88.9 | Plus |
LD34214.hyp Sequence
Translation from 384 to 575
> LD34214.hyp
MSWRRYVRPNKLQGNCVTCRNFHSTLSNAIRNRWTCCNINLTFYGPGRGS
STGMRPQSNAGQR*
LD34214.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:50:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31517-PB | 63 | CG31517-PB | 1..63 | 1..63 | 357 | 100 | Plus |
CG31517-PA | 63 | CG31517-PA | 1..63 | 1..63 | 357 | 100 | Plus |