Clone LD34214 Report

Search the DGRC for LD34214

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:342
Well:14
Vector:pOT2
Associated Gene/TranscriptCG31517-RA
Protein status:LD34214.pep: gold
Preliminary Size:1031
Sequenced Size:816

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31517 2001-10-10 Blastp of sequenced clone
CG31517 2003-01-01 Sim4 clustering to Release 3
CG31517 2008-04-29 Release 5.5 accounting
CG31517 2008-08-15 Release 5.9 accounting
CG31517 2008-12-18 5.12 accounting

Clone Sequence Records

LD34214.complete Sequence

816 bp (816 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061411

> LD34214.complete
ATAAATTAGCGAAATTTTAATTTGATTTCCTTCGCAAATTTCCGCCGAAC
TCGACTGTGGATTGGATGTGGACTGGATGTGGCCGGGTGTCGGAGTGTCT
GGCCAAGTGGACACAGAAGCCGAGGCAGCAAATAAACTAAGTGAATTTAT
GGCCCCAGGGCAGGAGCGGCACACGTGTGCGACATGCCCACACATTGACA
CCTACCAATAACCAACTATCAAGTACCGGCCATCCAATAAACGAACTAAC
CACATACTCCACACACACCACACTCCAATTGGGCTGCAGGTCCCTGGGCG
CGTTTTGGATCAGATCGTCTTGGTTCGGTTTTGGTTGGATGTTTTGTTTA
TGCTGGGCAGGCACAAACGAGCTGACAATGCCCCATGTCGTGGCGACGGT
ACGTGCGGCCAAACAAATTACAGGGAAATTGCGTCACCTGCAGGAATTTC
CACTCGACATTGTCAAATGCCATCAGAAATCGCTGGACATGTTGTAACAT
TAATTTGACATTTTACGGCCCAGGACGGGGATCGTCGACGGGAATGAGAC
CGCAGAGCAACGCAGGACAACGTTAAATCCACCAGCAGACAGCTGTCGAG
ATGACCAAAGATGCTGGAGCCACCAAGGGATCTTGCAGCAGCATCTCGGT
CACTCGGAAAAGTATGAGATACACTGAGAACACGGTCTACGAAGGAAGCA
CACAACTGTGGCAAGGATTGCTGAAGGATTCGCTTTCATGGCTATACACA
TACGAACGATGATGCTGTAAATATGAATAAAATATATATATAAATGAAAA
AAAAAAAAAAAAAAAA

LD34214.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:15:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG31517-RA 1007 CG31517-RA 194..991 1..798 3990 100 Plus
CG31517.a 1314 CG31517.a 107..904 1..798 3990 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:02:52
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 9773361..9773908 1..548 2740 100 Plus
chr3R 27901430 chr3R 9773991..9774240 547..796 1250 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:28:34 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:02:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13948451..13948998 1..548 2740 100 Plus
3R 32079331 3R 13949081..13949332 547..798 1260 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:38:41
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 13689282..13689829 1..548 2740 100 Plus
3R 31820162 3R 13689912..13690163 547..798 1260 100 Plus
Blast to na_te.dros performed on 2019-03-16 22:02:50 has no hits.

LD34214.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:03:36 Download gff for LD34214.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 9773361..9773908 1..548 100 -> Plus
chr3R 9773993..9774208 549..764 100 <- Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:16:10 Download gff for LD34214.complete
Subject Subject Range Query Range Percent Splice Strand
CG31517-RA 1..192 385..576 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:56:13 Download gff for LD34214.complete
Subject Subject Range Query Range Percent Splice Strand
CG31517-RA 1..192 385..576 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:08:29 Download gff for LD34214.complete
Subject Subject Range Query Range Percent Splice Strand
CG31517-RA 1..192 385..576 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:25:24 Download gff for LD34214.complete
Subject Subject Range Query Range Percent Splice Strand
CG31517-RA 1..192 385..576 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:30:53 Download gff for LD34214.complete
Subject Subject Range Query Range Percent Splice Strand
CG31517-RA 1..192 385..576 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:42:11 Download gff for LD34214.complete
Subject Subject Range Query Range Percent Splice Strand
CG31517-RA 17..812 1..796 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:56:12 Download gff for LD34214.complete
Subject Subject Range Query Range Percent Splice Strand
CG31517-RA 17..812 1..796 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:08:29 Download gff for LD34214.complete
Subject Subject Range Query Range Percent Splice Strand
CG31517-RA 17..812 1..796 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:25:25 Download gff for LD34214.complete
Subject Subject Range Query Range Percent Splice Strand
CG31517-RA 17..812 1..796 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:30:53 Download gff for LD34214.complete
Subject Subject Range Query Range Percent Splice Strand
CG31517-RA 32..827 1..796 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:03:36 Download gff for LD34214.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13948451..13948998 1..548 100 -> Plus
3R 13949083..13949330 549..796 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:03:36 Download gff for LD34214.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13948451..13948998 1..548 100 -> Plus
3R 13949083..13949330 549..796 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:03:36 Download gff for LD34214.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13948451..13948998 1..548 100 -> Plus
3R 13949083..13949330 549..796 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:08:29 Download gff for LD34214.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9774173..9774720 1..548 100 -> Plus
arm_3R 9774805..9775052 549..796 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:02:33 Download gff for LD34214.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13689282..13689829 1..548 100 -> Plus
3R 13689914..13690161 549..796 100   Plus

LD34214.pep Sequence

Translation from 384 to 575

> LD34214.pep
MSWRRYVRPNKLQGNCVTCRNFHSTLSNAIRNRWTCCNINLTFYGPGRGS
STGMRPQSNAGQR*

LD34214.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 10:01:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19884-PA 97 GG19884-PA 1..62 1..63 288 88.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:47:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG31517-PB 63 CG31517-PB 1..63 1..63 357 100 Plus
CG31517-PA 63 CG31517-PA 1..63 1..63 357 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 10:01:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24226-PA 180 GL24226-PA 10..54 6..50 207 84.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:01:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16294-PA 76 GA16294-PA 10..67 6..63 216 69 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 10:01:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24142-PA 63 GM24142-PA 1..63 1..63 314 93.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 10:01:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18938-PA 63 GD18938-PA 1..63 1..63 318 95.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 10:01:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26305-PA 131 GE26305-PA 1..62 1..63 288 88.9 Plus

LD34214.hyp Sequence

Translation from 384 to 575

> LD34214.hyp
MSWRRYVRPNKLQGNCVTCRNFHSTLSNAIRNRWTCCNINLTFYGPGRGS
STGMRPQSNAGQR*

LD34214.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:50:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG31517-PB 63 CG31517-PB 1..63 1..63 357 100 Plus
CG31517-PA 63 CG31517-PA 1..63 1..63 357 100 Plus