Clone LD34409 Report

Search the DGRC for LD34409

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:344
Well:9
Vector:pOT2
Associated Gene/TranscriptGdh-RE
Protein status:LD34409.pep: validated not full length
Sequenced Size:1636

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5320 2002-11-14 Blastp of sequenced clone
Gdh 2008-04-29 Release 5.5 accounting
Gdh 2008-08-15 Release 5.9 accounting
Gdh 2008-12-18 5.12 accounting

Clone Sequence Records

LD34409.complete Sequence

1636 bp (1636 high quality bases) assembled on 2002-11-14

GenBank Submission: BT001501

> LD34409.complete
AGTAGCGAGCGGTTGTGTAGAACAGAATAAAAAAAGAGTTGGAACCCGAA
GAATCCAAGCGATTAGCAGCATGTATCACCTGAAGATCAACCCTAAGGAG
TACTCCGAGCACGAGCTGGAGAAGATCACCCGTCGCTTCACCCTTGAGTT
GGCCAAGAAGGGCTTCATTGGACCCGGTGTCGATGTGCCCGCCCCCGACA
TGGGAACCGGTGAGCGCGAGATGTCCTGGATTGCCGATACTTATGCCAAG
ACCATCGGTCACCTGGACATCAATGCTCATGCCTGTGTCACCGGCAAGCC
CATCAACCAGGGCGGTATCCACGGACGCGTCTCGGCCACCGGTCGCGGTG
TCTTCCACGGCCTGGAGAACTTCATCAACGAGGCCAACTACATGAGCCAG
ATCGGCACCACTCCCGGCTGGGGCGGCAAGACCTTCATCGTCCAGGGCTT
CGGTAACGTGGGCCTGCACACCACTCGCTATCTGACCCGCGCCGGAGCCA
CCTGCATCGGTGTCATTGAGCACGACGGCACTCTGTACAACCCGGAGGGC
ATTGACCCTAAGCTGCTGGAGGACTACAAGAACGAGCACGGCACCATTGT
GGGCTACCAGAACGCCAAGCCCTACGAGGGCGAGAACCTCATGTTCGAGA
AGTGCGACATCTTCATTCCCGCTGCCGTCGAGAAGGTCATCACCAGCGAG
AATGCCAACCGCATTCAAGCTAAGATCATTGCCGAGGCTGCCAACGGCCC
CACCACCCCCGCTGCCGACAAGATCCTCATCGATCGCAACATCCTGGTCA
TTCCCGATCTGTACATCAACGCCGGTGGTGTCACCGTCTCCTTCTTCGAG
TGGCTGAAGAACCTGAACCACGTCTCGTACGGTCGCCTGACCTTCAAGTA
TGAGCGCGAGTCCAACTACCATCTGCTTGAATCCGTTCAAGAGTCCCTGG
AGCGTCGCTTCGGCCGTGTGGGCGGTCGCATCCCCGTGACCCCCTCCGAG
TCGTTCCAGAAGCGCATCTCCGGCGCCTCCGAGAAGGATATCGTGCACTC
CGGCCTGGACTACACCATGGAGCGCTCCGCCCGCGCCATCATGAAGACAG
CCATGAAGTACAACCTGGGCCTGGACCTCAGAACCGCTGCCTACGTCAAC
TCCATTGAGAAGATCTTCACCACATACCGCGATGCCGGCCTGGCCTTCTA
AGCCCGCTGAGTGTGCTGATTAGCCCCCAGACTCTTAACTAGTTAATTAA
GCAATCGAACTCAAGAGCATAACTATTGCTATTGCTCCATGCACCGCCGT
CTTAGATGAAAAGTCACAAAACCGAAATGCAAGAATCGTAATTTATATCT
ATGGCAATTGGAGCTGGCCAAAATAACTCTTTTAAAAAACAAAGCAAAAC
AAAAGCGAACTTTCGCCCGTGTTTCGTATTAAGTTGAACAAGTTGCGAGC
TTATTATTGTTGATTTTCTGTAATTTTTAAGTTAATGAGCGTCAAAGTGA
AGCAATTGCATTTTCAATTATGTATCGCAACGTCTCGTACCGTCAAGTCA
CGTTTATCGTACGATCGCTCCGTTGCCGTAACATTAAAATAATCAAATAT
ACACAAAACTAAACTCTAAAAAAAAAAAAAAAAAAA

LD34409.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:33:25
Subject Length Description Subject Range Query Range Score Percent Strand
Gdh-RF 2159 Gdh-RF 620..2159 80..1619 7700 100 Plus
Gdh-RA 2197 Gdh-RA 619..1484 80..945 4255 99.4 Plus
Gdh-RB 1830 Gdh-RB 254..1119 80..945 4255 99.4 Plus
Gdh-RA 2197 Gdh-RA 1507..2197 929..1619 3455 100 Plus
Gdh-RB 1830 Gdh-RB 1142..1830 929..1617 3445 100 Plus
Gdh-RA 2197 Gdh-RA 21..106 1..86 430 100 Plus
Gdh-RF 2159 Gdh-RF 22..107 1..86 430 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:35:37
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 19759388..19760076 1617..929 3430 99.9 Minus
chr3R 27901430 chr3R 19761550..19761875 405..80 1615 99.7 Minus
chr3R 27901430 chr3R 19761162..19761482 724..404 1605 100 Minus
chr3R 27901430 chr3R 19760855..19761059 927..723 1025 100 Minus
chr3R 27901430 chr3R 19766425..19766510 86..1 415 98.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:28:47 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:35:35
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23935955..23936646 1620..929 3460 100 Minus
3R 32079331 3R 23938120..23938445 405..80 1630 100 Minus
3R 32079331 3R 23937732..23938052 724..404 1605 100 Minus
3R 32079331 3R 23937423..23937629 929..723 1035 100 Minus
3R 32079331 3R 23942996..23943081 86..1 430 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:08:37
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 23676786..23677477 1620..929 3460 100 Minus
3R 31820162 3R 23678951..23679276 405..80 1630 100 Minus
3R 31820162 3R 23678563..23678883 724..404 1605 100 Minus
3R 31820162 3R 23678254..23678460 929..723 1035 100 Minus
3R 31820162 3R 23683827..23683912 86..1 430 100 Minus
Blast to na_te.dros performed on 2019-03-15 19:35:35 has no hits.

LD34409.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:36:37 Download gff for LD34409.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 19766425..19766510 1..86 98   Minus
chr3R 19761551..19761869 87..404 99 <- Minus
chr3R 19761162..19761481 405..724 100 <- Minus
chr3R 19759388..19760075 930..1617 99 <- Minus
chr3R 19760853..19761057 725..929 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:16:24 Download gff for LD34409.complete
Subject Subject Range Query Range Percent Splice Strand
Gdh-RF 529..1650 80..1201 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:04:33 Download gff for LD34409.complete
Subject Subject Range Query Range Percent Splice Strand
Gdh-RF 529..1650 80..1201 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 04:59:32 Download gff for LD34409.complete
Subject Subject Range Query Range Percent Splice Strand
Gdh-RF 529..1650 80..1201 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:54:45 Download gff for LD34409.complete
Subject Subject Range Query Range Percent Splice Strand
Gdh-RF 529..1650 80..1201 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:03:49 Download gff for LD34409.complete
Subject Subject Range Query Range Percent Splice Strand
Gdh-RF 529..1650 80..1201 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:23:48 Download gff for LD34409.complete
Subject Subject Range Query Range Percent Splice Strand
Gdh-RE 1..1618 1..1617 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:04:33 Download gff for LD34409.complete
Subject Subject Range Query Range Percent Splice Strand
Gdh-RF 22..105 1..85 98 -> Plus
Gdh-RF 626..2157 86..1617 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:59:32 Download gff for LD34409.complete
Subject Subject Range Query Range Percent Splice Strand
Gdh-RF 21..104 1..85 98 -> Plus
Gdh-RF 625..2156 86..1617 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:54:45 Download gff for LD34409.complete
Subject Subject Range Query Range Percent Splice Strand
Gdh-RE 1..1618 1..1617 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:03:49 Download gff for LD34409.complete
Subject Subject Range Query Range Percent Splice Strand
Gdh-RF 21..104 1..85 98 -> Plus
Gdh-RF 625..2156 86..1617 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:36:37 Download gff for LD34409.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23935958..23936645 930..1617 100 <- Minus
3R 23937423..23937627 725..929 100 <- Minus
3R 23937732..23938051 405..724 100 <- Minus
3R 23938121..23938439 87..404 99 <- Minus
3R 23942996..23943081 1..86 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:36:37 Download gff for LD34409.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23935958..23936645 930..1617 100 <- Minus
3R 23937423..23937627 725..929 100 <- Minus
3R 23937732..23938051 405..724 100 <- Minus
3R 23938121..23938439 87..404 99 <- Minus
3R 23942996..23943081 1..86 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:36:37 Download gff for LD34409.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23935958..23936645 930..1617 100 <- Minus
3R 23937423..23937627 725..929 100 <- Minus
3R 23937732..23938051 405..724 100 <- Minus
3R 23938121..23938439 87..404 99 <- Minus
3R 23942996..23943081 1..86 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:59:32 Download gff for LD34409.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19761680..19762367 930..1617 100 <- Minus
arm_3R 19763145..19763349 725..929 100 <- Minus
arm_3R 19763454..19763773 405..724 100 <- Minus
arm_3R 19763843..19764161 87..404 99 <- Minus
arm_3R 19768718..19768803 1..86 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:27:04 Download gff for LD34409.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23678952..23679270 87..404 99 <- Minus
3R 23683827..23683912 1..86 100   Minus
3R 23676789..23677476 930..1617 100 <- Minus
3R 23678254..23678458 725..929 100 <- Minus
3R 23678563..23678882 405..724 100 <- Minus

LD34409.pep Sequence

Translation from 70 to 1200

> LD34409.pep
MYHLKINPKEYSEHELEKITRRFTLELAKKGFIGPGVDVPAPDMGTGERE
MSWIADTYAKTIGHLDINAHACVTGKPINQGGIHGRVSATGRGVFHGLEN
FINEANYMSQIGTTPGWGGKTFIVQGFGNVGLHTTRYLTRAGATCIGVIE
HDGTLYNPEGIDPKLLEDYKNEHGTIVGYQNAKPYEGENLMFEKCDIFIP
AAVEKVITSENANRIQAKIIAEAANGPTTPAADKILIDRNILVIPDLYIN
AGGVTVSFFEWLKNLNHVSYGRLTFKYERESNYHLLESVQESLERRFGRV
GGRIPVTPSESFQKRISGASEKDIVHSGLDYTMERSARAIMKTAMKYNLG
LDLRTAAYVNSIEKIFTTYRDAGLAF*

LD34409.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 07:03:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17976-PA 561 GF17976-PA 176..561 4..376 1967 96.1 Plus
Dana\GF18014-PA 535 GF18014-PA 165..533 4..375 881 47.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 07:03:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12388-PA 562 GG12388-PA 177..562 4..376 1975 96.4 Plus
Dere\GG12444-PA 535 GG12444-PA 167..533 6..375 916 49.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:03:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19680-PA 557 GH19680-PA 172..557 4..376 1935 94.3 Plus
Dgri\GH20746-PA 535 GH20746-PA 165..533 4..375 909 48.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:03:49
Subject Length Description Subject Range Query Range Score Percent Strand
Gdh-PD 391 CG5320-PD 19..391 4..376 1955 100 Plus
Gdh-PF 549 CG5320-PF 177..549 4..376 1955 100 Plus
Gdh-PB 404 CG5320-PB 19..404 4..376 1931 96.6 Plus
Gdh-PA 562 CG5320-PA 177..562 4..376 1931 96.6 Plus
bb8-PA 535 CG4434-PA 167..533 6..375 878 48.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 07:03:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22276-PA 557 GI22276-PA 172..557 4..376 1935 94.3 Plus
Dmoj\GI23213-PA 522 GI23213-PA 154..520 4..375 935 49.5 Plus
Dmoj\GI23212-PA 507 GI23212-PA 138..505 4..375 925 49.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 07:03:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24163-PA 561 GL24163-PA 176..561 4..376 1960 95.9 Plus
Dper\GL23033-PA 533 GL23033-PA 163..531 4..375 908 48.5 Plus
Dper\GL15416-PA 77 GL15416-PA 1..63 314..376 171 61.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 07:03:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18802-PB 548 GA18802-PB 176..548 4..376 1983 99.2 Plus
Dpse\GA18802-PA 561 GA18802-PA 176..561 4..376 1960 95.9 Plus
Dpse\GA18802-PC 404 GA18802-PC 19..404 4..376 1954 95.9 Plus
Dpse\GA23808-PA 529 GA23808-PA 165..528 6..374 947 50.5 Plus
Dpse\GA18181-PA 533 GA18181-PA 163..531 4..375 901 48.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 07:03:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23525-PA 558 GM23525-PA 177..558 4..376 1976 97.4 Plus
Dsec\GM23576-PA 535 GM23576-PA 167..533 6..375 896 48.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 07:03:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18335-PA 562 GD18335-PA 177..562 4..376 1978 96.6 Plus
Dsim\GD18391-PA 535 GD18391-PA 167..533 6..375 896 48.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:03:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24069-PA 557 GJ24069-PA 172..557 4..376 1942 94.8 Plus
Dvir\GJ22871-PA 507 GJ22871-PA 138..505 4..375 924 49.3 Plus
Dvir\GJ22872-PA 535 GJ22872-PA 165..533 4..375 923 48.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:03:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11603-PA 562 GK11603-PA 177..562 4..376 1959 95.6 Plus
Dwil\GK11580-PA 534 GK11580-PA 164..532 4..375 903 48.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 07:03:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10843-PA 562 GE10843-PA 177..562 4..376 1975 96.4 Plus
Dyak\GE23967-PA 535 GE23967-PA 167..533 6..375 919 49.2 Plus

LD34409.hyp Sequence

Translation from 199 to 1200

> LD34409.hyp
MGTGEREMSWIADTYAKTIGHLDINAHACVTGKPINQGGIHGRVSATGRG
VFHGLENFINEANYMSQIGTTPGWGGKTFIVQGFGNVGLHTTRYLTRAGA
TCIGVIEHDGTLYNPEGIDPKLLEDYKNEHGTIVGYQNAKPYEGENLMFE
KCDIFIPAAVEKVITSENANRIQAKIIAEAANGPTTPAADKILIDRNILV
IPDLYINAGGVTVSFFEWLKNLNHVSYGRLTFKYERESNYHLLESVQESL
ERRFGRVGGRIPVTPSESFQKRISGASEKDIVHSGLDYTMERSARAIMKT
AMKYNLGLDLRTAAYVNSIEKIFTTYRDAGLAF*

LD34409.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:26:16
Subject Length Description Subject Range Query Range Score Percent Strand
Gdh-PD 391 CG5320-PD 59..391 1..333 1746 100 Plus
Gdh-PF 549 CG5320-PF 217..549 1..333 1746 100 Plus
Gdh-PB 404 CG5320-PB 59..404 1..333 1722 96.2 Plus
Gdh-PA 562 CG5320-PA 217..562 1..333 1722 96.2 Plus
CG4434-PA 535 CG4434-PA 205..533 1..332 741 47.1 Plus