Clone LD34436 Report

Search the DGRC for LD34436

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:344
Well:36
Vector:pOT2
Associated Gene/TranscriptmRpL19-RA
Protein status:LD34436.pep: gold
Preliminary Size:1121
Sequenced Size:1018

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8039 2001-01-01 Release 2 assignment
CG8039 2001-10-10 Blastp of sequenced clone
CG8039 2003-01-01 Sim4 clustering to Release 3
mRpL19 2008-04-29 Release 5.5 accounting
mRpL19 2008-08-15 Release 5.9 accounting
mRpL19 2008-12-18 5.12 accounting

Clone Sequence Records

LD34436.complete Sequence

1018 bp (1018 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061413

> LD34436.complete
TAAACATCAATTTGTTTCAGCCGATCCCGAAAACTATTCAAAATGAACTT
AAGCACAAGAGTTATGCTGAATAGGTTGACACAGCAGTGTGTCTACAAGC
GGATTGTGACCTTCTCCACCAAAACTGCGGAACATGTAATTGAAAATCAG
GAGGAACAGAAGAAAGAGGCTCCGCCAACCACGCCGACTTCACCGGTGAA
CCGGAAGACAATCATTCCGGCCAATTATCGGTTTGTTTACCCAGAATTCC
TGCCCGATCCGAAGGTGGAGTGGCGCAACCTCGTGCGCGAGAAGCTGGAG
CGACTGGACATGCTGGATCGCCGCAAACAGATCGACCTGCCCGAGTTCTA
CGTTGGATCTGTGCTTGCGGTGACAAGTTCGGATCCCCATGCCGCTGGCA
AAACCAGTCGATTTGTGGGTATCTGTATCAATAGGGATCGCTGTGGACTG
CGCGCCCGTTTCATTCTTCGCAACGTGATTGATCACCAGGGAATGGAGGT
GGTCTACGAGCTGTATGATCCTACCATCCTAAAGATCGAGGTGTTGCGGC
TAGAGAAGCGACTGGATGACAGTCTTTTCTACCTGCGGGACGCTCTTCCG
GAGTACAGTACTTTTGATGAGAACATGGAGGCCGAGCCGCTCGAGGAGGG
TGCTCCGGTGCCGGTGAACGACATTAAGGTGGTGCTCCGTCCGCGTCCAT
GGCTGGAGCGCTGGGAACGACAGAATCTGCGTGGTGTGGCCAACATCGAT
GAGTATCTAAAAGACAAGCATCGCCTGTCGGCGGCCAAGGTGCAGAAACC
ATGGGAGAAGTACGACATGATGAAGGACTACCGCAGCTCGATTCCCGAGG
AGGAGCAGACGGAGATCTTCGCCGAGGTGCACACGGAACTGCACGCCCTG
GAGCTGCAGCGAAAACGCAACAAGCGCAAGCGCACTTTCATTAAGCCCAA
GCAGCTGGCGTAATTGCATTTGTTGTTCATTTTTTAGAATAAAAATATCG
AAAAAAAAAAAAAAAAAA

LD34436.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:13:27
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL19-RA 1139 mRpL19-RA 105..1110 1..1006 5030 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:17:11
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 4500274..4501168 106..1000 4475 100 Plus
chr3R 27901430 chr3R 4500117..4500222 1..106 530 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:28:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:17:09
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8674302..8675202 106..1006 4505 100 Plus
3R 32079331 3R 8674145..8674250 1..106 530 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:37:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 8415133..8416033 106..1006 4505 100 Plus
3R 31820162 3R 8414976..8415081 1..106 530 100 Plus
Blast to na_te.dros performed on 2019-03-16 01:17:09 has no hits.

LD34436.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:18:22 Download gff for LD34436.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 4500117..4500222 1..106 100 -> Plus
chr3R 4500275..4501168 107..1000 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:16:26 Download gff for LD34436.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL19-RA 1..921 43..963 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:53:46 Download gff for LD34436.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL19-RA 1..921 43..963 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:04:42 Download gff for LD34436.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL19-RA 1..921 43..963 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:22:47 Download gff for LD34436.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL19-RA 1..921 43..963 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:29:41 Download gff for LD34436.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL19-RA 1..921 43..963 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:39:03 Download gff for LD34436.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL19-RA 29..1028 1..1000 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:53:46 Download gff for LD34436.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL19-RA 29..1028 1..1000 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:04:42 Download gff for LD34436.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL19-RA 37..1036 1..1000 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:22:47 Download gff for LD34436.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL19-RA 29..1028 1..1000 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:29:41 Download gff for LD34436.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL19-RA 37..1036 1..1000 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:18:22 Download gff for LD34436.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8674145..8674250 1..106 100 -> Plus
3R 8674303..8675196 107..1000 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:18:22 Download gff for LD34436.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8674145..8674250 1..106 100 -> Plus
3R 8674303..8675196 107..1000 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:18:22 Download gff for LD34436.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8674145..8674250 1..106 100 -> Plus
3R 8674303..8675196 107..1000 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:04:42 Download gff for LD34436.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4499867..4499972 1..106 100 -> Plus
arm_3R 4500025..4500918 107..1000 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:59:54 Download gff for LD34436.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8415134..8416027 107..1000 100   Plus
3R 8414976..8415081 1..106 100 -> Plus

LD34436.pep Sequence

Translation from 42 to 962

> LD34436.pep
MNLSTRVMLNRLTQQCVYKRIVTFSTKTAEHVIENQEEQKKEAPPTTPTS
PVNRKTIIPANYRFVYPEFLPDPKVEWRNLVREKLERLDMLDRRKQIDLP
EFYVGSVLAVTSSDPHAAGKTSRFVGICINRDRCGLRARFILRNVIDHQG
MEVVYELYDPTILKIEVLRLEKRLDDSLFYLRDALPEYSTFDENMEAEPL
EEGAPVPVNDIKVVLRPRPWLERWERQNLRGVANIDEYLKDKHRLSAAKV
QKPWEKYDMMKDYRSSIPEEEQTEIFAEVHTELHALELQRKRNKRKRTFI
KPKQLA*

LD34436.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:44:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18180-PA 313 GF18180-PA 1..313 1..306 1336 78.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:44:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11838-PA 306 GG11838-PA 1..306 1..306 1568 96.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:44:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18570-PA 302 GH18570-PA 1..302 1..306 1307 79.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:38:48
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL19-PA 306 CG8039-PA 1..306 1..306 1596 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:44:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24767-PA 470 GI24767-PA 176..470 7..306 1275 79.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:44:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12468-PA 319 GL12468-PA 3..319 4..306 1300 77.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:44:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20783-PA 319 GA20783-PA 3..319 4..306 1287 77 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:44:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23749-PA 306 GM23749-PA 1..306 1..306 1580 97.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:44:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18561-PA 306 GD18561-PA 1..306 1..306 1595 98.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:44:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22671-PA 301 GJ22671-PA 1..301 1..306 1334 81.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:44:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11808-PA 305 GK11808-PA 3..305 1..306 1301 79.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:44:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25893-PA 306 GE25893-PA 1..306 1..306 1586 97.7 Plus

LD34436.hyp Sequence

Translation from 42 to 962

> LD34436.hyp
MNLSTRVMLNRLTQQCVYKRIVTFSTKTAEHVIENQEEQKKEAPPTTPTS
PVNRKTIIPANYRFVYPEFLPDPKVEWRNLVREKLERLDMLDRRKQIDLP
EFYVGSVLAVTSSDPHAAGKTSRFVGICINRDRCGLRARFILRNVIDHQG
MEVVYELYDPTILKIEVLRLEKRLDDSLFYLRDALPEYSTFDENMEAEPL
EEGAPVPVNDIKVVLRPRPWLERWERQNLRGVANIDEYLKDKHRLSAAKV
QKPWEKYDMMKDYRSSIPEEEQTEIFAEVHTELHALELQRKRNKRKRTFI
KPKQLA*

LD34436.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:22:14
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL19-PA 306 CG8039-PA 1..306 1..306 1596 100 Plus