![]() | BDGP Sequence Production Resources |
Search the DGRC for LD34461
Library: | LD |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Ling Hong |
Date Registered: | 1997-12-04 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 344 |
Well: | 61 |
Vector: | pOT2 |
Associated Gene/Transcript | Tom20-RA |
Protein status: | LD34461.pep: gold |
Preliminary Size: | 877 |
Sequenced Size: | 733 |
Gene | Date | Evidence |
---|---|---|
CG7654 | 2001-01-01 | Release 2 assignment |
CG7654 | 2001-10-10 | Blastp of sequenced clone |
CG7654 | 2003-01-01 | Sim4 clustering to Release 3 |
Tom20 | 2008-04-29 | Release 5.5 accounting |
Tom20 | 2008-08-15 | Release 5.9 accounting |
Tom20 | 2008-12-18 | 5.12 accounting |
733 bp (733 high quality bases) assembled on 2001-10-10
GenBank Submission: AY061414
> LD34461.complete CGGAATGTAAAATAAGACCAAGTTAATACAGAGGATTTCCGTAGTAATAT GATTGAAATGAACAAAACTGCAATCGGCATTGCAGCGGGAGTAGCTGGAA CTCTGTTTATTGGATACTGCATCTACTTCGACAAGAAGCGCCGCAGCGAT CCCGAGTACAAGAAGAAAGTCCGTGAGCGTCGCCGTCGCAACAAGAAAAC CGGCACTGCCAAGTCTGGAGTTCCCAATCTGAACGACCATGAAGCCATCG AAAGATATTTCCTTCAAGAAATCCAGCTGGGCGAGACCCTGATCGCCCGC GGAGATTTCGAGAGTGGCGTGGAGCACTTGGCGAATGCCATCGTCGTGTG TGGCCAGCCGGCTCGTCTGCTGCAGGTGCTGCAATCCTCCCTTCCAGCTC AAGTATTCGCGATGCTGATCGTCAAGATGCAGGAGTTCGGCAATCGAGCG GCCGAGGGCAACGACGGGCCAATCGTTTTGGGGCAGAGCTCGGAGCAACA ACTGGACGGAGCCAAAATTATAGAGTGTTCATCTGGAAACGCAAGTATCG ACGACCTCGAATAGTACTTGGAGATGGCTACAGAAATTGAGATATAAATT TCAACAGTAGAAATTAAGGGCTTCACATATAAACATTATATTTTTTTTAT ATATTGATTTCTCTGGATGTTCCCAATACATACAAATAAATATGCGTAAA CTGTTAACACTTAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 19991162..19991621 | 253..712 | 2300 | 100 | Plus |
chr3L | 24539361 | chr3L | 19990433..19990612 | 1..180 | 900 | 100 | Plus |
chr3L | 24539361 | chr3L | 19990675..19990750 | 179..254 | 380 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 20001848..20002309 | 253..714 | 2310 | 100 | Plus |
3L | 28110227 | 3L | 20001119..20001298 | 1..180 | 900 | 100 | Plus |
3L | 28110227 | 3L | 20001361..20001436 | 179..254 | 380 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 19994948..19995409 | 253..714 | 2310 | 100 | Plus |
3L | 28103327 | 3L | 19994219..19994398 | 1..180 | 900 | 100 | Plus |
3L | 28103327 | 3L | 19994461..19994536 | 179..254 | 380 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 19990433..19990610 | 1..178 | 100 | -> | Plus |
chr3L | 19990675..19990750 | 179..254 | 100 | -> | Plus |
chr3L | 19991164..19991621 | 255..712 | 93 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tom20-RA | 1..516 | 49..564 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tom20-RA | 1..516 | 49..564 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tom20-RA | 1..516 | 49..564 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tom20-RA | 1..516 | 49..564 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tom20-RA | 1..516 | 49..564 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tom20-RA | 31..742 | 1..712 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tom20-RA | 33..744 | 1..712 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tom20-RA | 32..743 | 1..712 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tom20-RA | 31..742 | 1..712 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Tom20-RA | 32..743 | 1..712 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 20001119..20001296 | 1..178 | 100 | -> | Plus |
3L | 20001361..20001436 | 179..254 | 100 | -> | Plus |
3L | 20001850..20002307 | 255..712 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 20001119..20001296 | 1..178 | 100 | -> | Plus |
3L | 20001361..20001436 | 179..254 | 100 | -> | Plus |
3L | 20001850..20002307 | 255..712 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 20001119..20001296 | 1..178 | 100 | -> | Plus |
3L | 20001361..20001436 | 179..254 | 100 | -> | Plus |
3L | 20001850..20002307 | 255..712 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 19994219..19994396 | 1..178 | 100 | -> | Plus |
arm_3L | 19994461..19994536 | 179..254 | 100 | -> | Plus |
arm_3L | 19994950..19995407 | 255..712 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 19994950..19995407 | 255..712 | 100 | Plus | |
3L | 19994219..19994396 | 1..178 | 100 | -> | Plus |
3L | 19994461..19994536 | 179..254 | 100 | -> | Plus |
Translation from 48 to 563
> LD34461.pep MIEMNKTAIGIAAGVAGTLFIGYCIYFDKKRRSDPEYKKKVRERRRRNKK TGTAKSGVPNLNDHEAIERYFLQEIQLGETLIARGDFESGVEHLANAIVV CGQPARLLQVLQSSLPAQVFAMLIVKMQEFGNRAAEGNDGPIVLGQSSEQ QLDGAKIIECSSGNASIDDLE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23612-PA | 170 | GF23612-PA | 1..170 | 1..171 | 747 | 93.6 | Plus |
Dana\GF17442-PA | 145 | GF17442-PA | 8..136 | 13..143 | 364 | 52.7 | Plus |
Dana\GF20199-PA | 144 | GF20199-PA | 11..143 | 7..133 | 297 | 41.9 | Plus |
Dana\GF20479-PA | 146 | GF20479-PA | 6..124 | 8..128 | 262 | 43 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG16077-PA | 171 | GG16077-PA | 1..171 | 1..171 | 895 | 99.4 | Plus |
Dere\GG17273-PA | 148 | GG17273-PA | 10..148 | 11..153 | 338 | 43.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14388-PA | 168 | GH14388-PA | 1..168 | 1..171 | 632 | 81.4 | Plus |
Dgri\GH17358-PA | 157 | GH17358-PA | 6..137 | 4..136 | 385 | 53.7 | Plus |
Dgri\GH17969-PA | 159 | GH17969-PA | 3..138 | 5..135 | 317 | 43.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Tom20-PB | 171 | CG7654-PB | 1..171 | 1..171 | 865 | 100 | Plus |
Tom20-PA | 171 | CG7654-PA | 1..171 | 1..171 | 865 | 100 | Plus |
tomboy20-PA | 147 | CG14690-PA | 10..128 | 11..130 | 328 | 47.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI11331-PA | 169 | GI11331-PA | 1..169 | 1..171 | 649 | 79.5 | Plus |
Dmoj\GI23896-PA | 157 | GI23896-PA | 6..135 | 4..134 | 414 | 55.7 | Plus |
Dmoj\GI21634-PA | 150 | GI21634-PA | 5..133 | 7..130 | 321 | 42.6 | Plus |
Dmoj\GI21625-PA | 175 | GI21625-PA | 9..139 | 11..130 | 276 | 40.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11896-PA | 166 | GL11896-PA | 1..166 | 1..171 | 662 | 83.6 | Plus |
Dper\GL23695-PA | 189 | GL23695-PA | 10..149 | 11..139 | 275 | 36.4 | Plus |
Dper\GL12626-PA | 172 | GL12626-PA | 1..145 | 4..129 | 253 | 37.9 | Plus |
Dper\GL25092-PA | 243 | GL25092-PA | 10..163 | 14..130 | 238 | 35.1 | Plus |
Dper\GL19377-PA | 200 | GL19377-PA | 11..161 | 15..130 | 226 | 32.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA29327-PA | 166 | GA29327-PA | 1..166 | 1..171 | 662 | 83.6 | Plus |
Dpse\GA29170-PA | 228 | GA29170-PA | 10..150 | 11..133 | 282 | 39 | Plus |
Dpse\GA27573-PA | 172 | GA27573-PA | 1..145 | 4..129 | 253 | 37.9 | Plus |
Dpse\GA26707-PA | 186 | GA26707-PA | 10..146 | 11..139 | 251 | 35.8 | Plus |
Dpse\GA22942-PA | 243 | GA22942-PA | 13..163 | 17..130 | 230 | 34.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM19743-PA | 171 | GM19743-PA | 1..171 | 1..171 | 902 | 100 | Plus |
Dsec\GM26157-PA | 147 | GM26157-PA | 10..128 | 11..130 | 339 | 48.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14848-PA | 171 | GD14848-PA | 1..171 | 1..171 | 902 | 100 | Plus |
Dsim\GD20710-PA | 147 | GD20710-PA | 10..128 | 11..130 | 339 | 48.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ11588-PA | 169 | GJ11588-PA | 1..169 | 1..171 | 656 | 81.3 | Plus |
Dvir\GJ23989-PA | 157 | GJ23989-PA | 4..131 | 2..130 | 414 | 55.8 | Plus |
Dvir\GJ16867-PA | 164 | GJ16867-PA | 7..141 | 6..130 | 339 | 47.4 | Plus |
Dvir\GJ16865-PA | 153 | GJ16865-PA | 5..136 | 7..130 | 316 | 41.7 | Plus |
Dvir\GJ18805-PA | 168 | GJ18805-PA | 10..168 | 11..164 | 227 | 33.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK18666-PA | 165 | GK18666-PA | 1..165 | 4..171 | 665 | 86.9 | Plus |
Dwil\GK19183-PA | 172 | GK19183-PA | 6..152 | 6..152 | 377 | 47.3 | Plus |
Dwil\GK16485-PA | 180 | GK16485-PA | 4..152 | 6..129 | 323 | 44.3 | Plus |
Dwil\GK16136-PA | 195 | GK16136-PA | 11..157 | 13..131 | 313 | 40.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE19643-PA | 171 | GE19643-PA | 1..171 | 1..171 | 892 | 98.8 | Plus |
Dyak\GE23225-PA | 168 | GE23225-PA | 1..168 | 4..171 | 876 | 98.8 | Plus |
Dyak\GE24674-PA | 148 | GE24674-PA | 7..148 | 8..153 | 347 | 44.2 | Plus |
Translation from 48 to 563
> LD34461.hyp MIEMNKTAIGIAAGVAGTLFIGYCIYFDKKRRSDPEYKKKVRERRRRNKK TGTAKSGVPNLNDHEAIERYFLQEIQLGETLIARGDFESGVEHLANAIVV CGQPARLLQVLQSSLPAQVFAMLIVKMQEFGNRAAEGNDGPIVLGQSSEQ QLDGAKIIECSSGNASIDDLE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Tom20-PB | 171 | CG7654-PB | 1..171 | 1..171 | 865 | 100 | Plus |
Tom20-PA | 171 | CG7654-PA | 1..171 | 1..171 | 865 | 100 | Plus |
tomboy20-PA | 147 | CG14690-PA | 10..128 | 11..130 | 328 | 47.5 | Plus |