Clone LD34461 Report

Search the DGRC for LD34461

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:344
Well:61
Vector:pOT2
Associated Gene/TranscriptTom20-RA
Protein status:LD34461.pep: gold
Preliminary Size:877
Sequenced Size:733

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7654 2001-01-01 Release 2 assignment
CG7654 2001-10-10 Blastp of sequenced clone
CG7654 2003-01-01 Sim4 clustering to Release 3
Tom20 2008-04-29 Release 5.5 accounting
Tom20 2008-08-15 Release 5.9 accounting
Tom20 2008-12-18 5.12 accounting

Clone Sequence Records

LD34461.complete Sequence

733 bp (733 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061414

> LD34461.complete
CGGAATGTAAAATAAGACCAAGTTAATACAGAGGATTTCCGTAGTAATAT
GATTGAAATGAACAAAACTGCAATCGGCATTGCAGCGGGAGTAGCTGGAA
CTCTGTTTATTGGATACTGCATCTACTTCGACAAGAAGCGCCGCAGCGAT
CCCGAGTACAAGAAGAAAGTCCGTGAGCGTCGCCGTCGCAACAAGAAAAC
CGGCACTGCCAAGTCTGGAGTTCCCAATCTGAACGACCATGAAGCCATCG
AAAGATATTTCCTTCAAGAAATCCAGCTGGGCGAGACCCTGATCGCCCGC
GGAGATTTCGAGAGTGGCGTGGAGCACTTGGCGAATGCCATCGTCGTGTG
TGGCCAGCCGGCTCGTCTGCTGCAGGTGCTGCAATCCTCCCTTCCAGCTC
AAGTATTCGCGATGCTGATCGTCAAGATGCAGGAGTTCGGCAATCGAGCG
GCCGAGGGCAACGACGGGCCAATCGTTTTGGGGCAGAGCTCGGAGCAACA
ACTGGACGGAGCCAAAATTATAGAGTGTTCATCTGGAAACGCAAGTATCG
ACGACCTCGAATAGTACTTGGAGATGGCTACAGAAATTGAGATATAAATT
TCAACAGTAGAAATTAAGGGCTTCACATATAAACATTATATTTTTTTTAT
ATATTGATTTCTCTGGATGTTCCCAATACATACAAATAAATATGCGTAAA
CTGTTAACACTTAAAAAAAAAAAAAAAAAAAAA

LD34461.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:00:29
Subject Length Description Subject Range Query Range Score Percent Strand
Tom20-RA 980 Tom20-RA 130..843 1..714 3570 100 Plus
Tom20.a 738 Tom20.a 33..738 1..712 3445 99.1 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:23:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 19991162..19991621 253..712 2300 100 Plus
chr3L 24539361 chr3L 19990433..19990612 1..180 900 100 Plus
chr3L 24539361 chr3L 19990675..19990750 179..254 380 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:28:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:23:36
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 20001848..20002309 253..714 2310 100 Plus
3L 28110227 3L 20001119..20001298 1..180 900 100 Plus
3L 28110227 3L 20001361..20001436 179..254 380 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:32:22
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 19994948..19995409 253..714 2310 100 Plus
3L 28103327 3L 19994219..19994398 1..180 900 100 Plus
3L 28103327 3L 19994461..19994536 179..254 380 100 Plus
Blast to na_te.dros performed on 2019-03-16 05:23:36 has no hits.

LD34461.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:24:34 Download gff for LD34461.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 19990433..19990610 1..178 100 -> Plus
chr3L 19990675..19990750 179..254 100 -> Plus
chr3L 19991164..19991621 255..712 93   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:16:28 Download gff for LD34461.complete
Subject Subject Range Query Range Percent Splice Strand
Tom20-RA 1..516 49..564 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:40:39 Download gff for LD34461.complete
Subject Subject Range Query Range Percent Splice Strand
Tom20-RA 1..516 49..564 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:09:56 Download gff for LD34461.complete
Subject Subject Range Query Range Percent Splice Strand
Tom20-RA 1..516 49..564 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:32:34 Download gff for LD34461.complete
Subject Subject Range Query Range Percent Splice Strand
Tom20-RA 1..516 49..564 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:04:20 Download gff for LD34461.complete
Subject Subject Range Query Range Percent Splice Strand
Tom20-RA 1..516 49..564 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:14:22 Download gff for LD34461.complete
Subject Subject Range Query Range Percent Splice Strand
Tom20-RA 31..742 1..712 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:40:39 Download gff for LD34461.complete
Subject Subject Range Query Range Percent Splice Strand
Tom20-RA 33..744 1..712 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:09:56 Download gff for LD34461.complete
Subject Subject Range Query Range Percent Splice Strand
Tom20-RA 32..743 1..712 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:32:35 Download gff for LD34461.complete
Subject Subject Range Query Range Percent Splice Strand
Tom20-RA 31..742 1..712 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:04:20 Download gff for LD34461.complete
Subject Subject Range Query Range Percent Splice Strand
Tom20-RA 32..743 1..712 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:24:34 Download gff for LD34461.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20001119..20001296 1..178 100 -> Plus
3L 20001361..20001436 179..254 100 -> Plus
3L 20001850..20002307 255..712 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:24:34 Download gff for LD34461.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20001119..20001296 1..178 100 -> Plus
3L 20001361..20001436 179..254 100 -> Plus
3L 20001850..20002307 255..712 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:24:34 Download gff for LD34461.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20001119..20001296 1..178 100 -> Plus
3L 20001361..20001436 179..254 100 -> Plus
3L 20001850..20002307 255..712 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:09:56 Download gff for LD34461.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 19994219..19994396 1..178 100 -> Plus
arm_3L 19994461..19994536 179..254 100 -> Plus
arm_3L 19994950..19995407 255..712 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:05:00 Download gff for LD34461.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19994950..19995407 255..712 100   Plus
3L 19994219..19994396 1..178 100 -> Plus
3L 19994461..19994536 179..254 100 -> Plus

LD34461.pep Sequence

Translation from 48 to 563

> LD34461.pep
MIEMNKTAIGIAAGVAGTLFIGYCIYFDKKRRSDPEYKKKVRERRRRNKK
TGTAKSGVPNLNDHEAIERYFLQEIQLGETLIARGDFESGVEHLANAIVV
CGQPARLLQVLQSSLPAQVFAMLIVKMQEFGNRAAEGNDGPIVLGQSSEQ
QLDGAKIIECSSGNASIDDLE*

LD34461.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:19:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23612-PA 170 GF23612-PA 1..170 1..171 747 93.6 Plus
Dana\GF17442-PA 145 GF17442-PA 8..136 13..143 364 52.7 Plus
Dana\GF20199-PA 144 GF20199-PA 11..143 7..133 297 41.9 Plus
Dana\GF20479-PA 146 GF20479-PA 6..124 8..128 262 43 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:19:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16077-PA 171 GG16077-PA 1..171 1..171 895 99.4 Plus
Dere\GG17273-PA 148 GG17273-PA 10..148 11..153 338 43.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 04:19:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14388-PA 168 GH14388-PA 1..168 1..171 632 81.4 Plus
Dgri\GH17358-PA 157 GH17358-PA 6..137 4..136 385 53.7 Plus
Dgri\GH17969-PA 159 GH17969-PA 3..138 5..135 317 43.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:22:49
Subject Length Description Subject Range Query Range Score Percent Strand
Tom20-PB 171 CG7654-PB 1..171 1..171 865 100 Plus
Tom20-PA 171 CG7654-PA 1..171 1..171 865 100 Plus
tomboy20-PA 147 CG14690-PA 10..128 11..130 328 47.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 04:19:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11331-PA 169 GI11331-PA 1..169 1..171 649 79.5 Plus
Dmoj\GI23896-PA 157 GI23896-PA 6..135 4..134 414 55.7 Plus
Dmoj\GI21634-PA 150 GI21634-PA 5..133 7..130 321 42.6 Plus
Dmoj\GI21625-PA 175 GI21625-PA 9..139 11..130 276 40.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 04:19:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11896-PA 166 GL11896-PA 1..166 1..171 662 83.6 Plus
Dper\GL23695-PA 189 GL23695-PA 10..149 11..139 275 36.4 Plus
Dper\GL12626-PA 172 GL12626-PA 1..145 4..129 253 37.9 Plus
Dper\GL25092-PA 243 GL25092-PA 10..163 14..130 238 35.1 Plus
Dper\GL19377-PA 200 GL19377-PA 11..161 15..130 226 32.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:19:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA29327-PA 166 GA29327-PA 1..166 1..171 662 83.6 Plus
Dpse\GA29170-PA 228 GA29170-PA 10..150 11..133 282 39 Plus
Dpse\GA27573-PA 172 GA27573-PA 1..145 4..129 253 37.9 Plus
Dpse\GA26707-PA 186 GA26707-PA 10..146 11..139 251 35.8 Plus
Dpse\GA22942-PA 243 GA22942-PA 13..163 17..130 230 34.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:19:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19743-PA 171 GM19743-PA 1..171 1..171 902 100 Plus
Dsec\GM26157-PA 147 GM26157-PA 10..128 11..130 339 48.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:19:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14848-PA 171 GD14848-PA 1..171 1..171 902 100 Plus
Dsim\GD20710-PA 147 GD20710-PA 10..128 11..130 339 48.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 04:19:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11588-PA 169 GJ11588-PA 1..169 1..171 656 81.3 Plus
Dvir\GJ23989-PA 157 GJ23989-PA 4..131 2..130 414 55.8 Plus
Dvir\GJ16867-PA 164 GJ16867-PA 7..141 6..130 339 47.4 Plus
Dvir\GJ16865-PA 153 GJ16865-PA 5..136 7..130 316 41.7 Plus
Dvir\GJ18805-PA 168 GJ18805-PA 10..168 11..164 227 33.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 04:19:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18666-PA 165 GK18666-PA 1..165 4..171 665 86.9 Plus
Dwil\GK19183-PA 172 GK19183-PA 6..152 6..152 377 47.3 Plus
Dwil\GK16485-PA 180 GK16485-PA 4..152 6..129 323 44.3 Plus
Dwil\GK16136-PA 195 GK16136-PA 11..157 13..131 313 40.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:19:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19643-PA 171 GE19643-PA 1..171 1..171 892 98.8 Plus
Dyak\GE23225-PA 168 GE23225-PA 1..168 4..171 876 98.8 Plus
Dyak\GE24674-PA 148 GE24674-PA 7..148 8..153 347 44.2 Plus

LD34461.hyp Sequence

Translation from 48 to 563

> LD34461.hyp
MIEMNKTAIGIAAGVAGTLFIGYCIYFDKKRRSDPEYKKKVRERRRRNKK
TGTAKSGVPNLNDHEAIERYFLQEIQLGETLIARGDFESGVEHLANAIVV
CGQPARLLQVLQSSLPAQVFAMLIVKMQEFGNRAAEGNDGPIVLGQSSEQ
QLDGAKIIECSSGNASIDDLE*

LD34461.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:45:17
Subject Length Description Subject Range Query Range Score Percent Strand
Tom20-PB 171 CG7654-PB 1..171 1..171 865 100 Plus
Tom20-PA 171 CG7654-PA 1..171 1..171 865 100 Plus
tomboy20-PA 147 CG14690-PA 10..128 11..130 328 47.5 Plus