Clone LD34542 Report

Search the DGRC for LD34542

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:345
Well:42
Vector:pOT2
Associated Gene/TranscriptCG7789-RA
Protein status:LD34542.pep: gold
Preliminary Size:1340
Sequenced Size:1123

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7789 2001-01-01 Release 2 assignment
CG7789 2002-05-31 Blastp of sequenced clone
CG7789 2003-01-01 Sim4 clustering to Release 3
CG7789 2008-04-29 Release 5.5 accounting
CG7789 2008-08-15 Release 5.9 accounting
CG7789 2008-12-18 5.12 accounting

Clone Sequence Records

LD34542.complete Sequence

1123 bp (1123 high quality bases) assembled on 2002-05-31

GenBank Submission: AY118554

> LD34542.complete
AAAACATCTCATTCCAATCTTGAAAAGATCTCCCGCATCCTTGTCCCATA
CAAATAAAATAACGATGGCTGCAACTGCTCCGGTAATTATGCGCGTCATG
GCGTCCTCGATCAGCACCGCCAAGCGGGCTGGCGGCATCATACGCGACGT
GCTCAAGAAGGGTGACCTGGGCATAGTGGACAAGGGCAAGAACGATCCGC
AGACGGAGGCAGATCGCTCTGCCCAGCGTTGCATTATCGCCTCCTTGGCC
AAAAAGTTCCCCACCGTCAAGATCATTGGCGAGGAGGGTGGATCCGATCT
GAATGTCTGCGACGACTGGCTGGTGAACGAGTTGGATGAGGAATTCCTGC
AGCACAGTTGCCCCGCTGAGTGGAAGGATGTCAAGCCCGAGGACTTTGTC
ATATGGGTAGATCCCCTAGACGGCACAGCGGAGTATACACAGGGACACGT
TGAACACGTGACCGTCCTGATCGGCATAGCCGTGAAGGATGCTGCTGTGG
GCGGCATCATTCATCAGCCATTCTACCAACAGCCCGATGGCGAAATGGGT
CGCACCATTTGGGGCCTGAAGGGTCTGGGCACGGGAGGATTCACGGCAGT
CCCCGCGCCAGCCGGCCAGTTCATCATAACCACCACTCGCTCGCATTCCA
ATGCCCTGCATCAGCAAGCCCTCAACGCATTCGCATCCACAGAAGTTCTG
AAAGTCGGAGGCGCTGGGTTCAAAGTGCTCCAGCTGCTGGAGGGAAAGGC
CCACGCGTACGTCTTCGCCACGCCGGGCTGCAAGAAGTGGGACACCTGCG
CACCCGAGGCCGTTCTAGAGGCCCAGGGCGGCTGCCTCACCAACATCAAC
GGCGAGCACTACGCCTACAATGCGGATGTGGAGCACGTGAATCGACAGGG
AGTGCTGGCCAGCCTGGGACAGGACCATGCCGCGCTGGTGGAAAAGATTC
CCGCCGAGGTGCGGGCAGCAGTGGGAGCCAAGTGAGATAGCTTTGAATTC
CAGCACTTTATTAGTTTATTTGCACTAAAAGTAAACACACATAAATTAAG
CAATAACAGGTTAGAAATTTGAAAATTGTTAAAACTGGAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAA

LD34542.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:55:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG7789-RA 1259 CG7789-RA 172..1259 1..1088 5440 100 Plus
ncd-RA 2770 ncd-RA 2657..2770 1088..975 570 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:09:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 25626299..25626944 443..1088 3230 100 Plus
chr3R 27901430 chr3R 25625793..25626236 1..444 2205 99.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:28:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:09:14
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29803744..29804389 443..1088 3230 100 Plus
3R 32079331 3R 29803238..29803681 1..444 2220 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:28:11
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29544575..29545220 443..1088 3230 100 Plus
3R 31820162 3R 29544069..29544512 1..444 2220 100 Plus
Blast to na_te.dros performed on 2019-03-16 11:09:14 has no hits.

LD34542.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:10:16 Download gff for LD34542.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 25625793..25626235 1..443 99 -> Plus
chr3R 25626300..25626944 444..1088 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:16:34 Download gff for LD34542.complete
Subject Subject Range Query Range Percent Splice Strand
CG7789-RA 1..921 65..985 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:34:06 Download gff for LD34542.complete
Subject Subject Range Query Range Percent Splice Strand
CG7789-RA 1..921 65..985 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:36:48 Download gff for LD34542.complete
Subject Subject Range Query Range Percent Splice Strand
CG7789-RA 1..921 65..985 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:25:39 Download gff for LD34542.complete
Subject Subject Range Query Range Percent Splice Strand
CG7789-RA 1..921 65..985 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:28:47 Download gff for LD34542.complete
Subject Subject Range Query Range Percent Splice Strand
CG7789-RA 1..921 65..985 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:05:11 Download gff for LD34542.complete
Subject Subject Range Query Range Percent Splice Strand
CG7789-RA 42..1125 1..1084 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:34:06 Download gff for LD34542.complete
Subject Subject Range Query Range Percent Splice Strand
CG7789-RA 42..1125 1..1084 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:36:48 Download gff for LD34542.complete
Subject Subject Range Query Range Percent Splice Strand
CG7789-RA 43..1130 1..1088 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:25:40 Download gff for LD34542.complete
Subject Subject Range Query Range Percent Splice Strand
CG7789-RA 42..1125 1..1084 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:28:47 Download gff for LD34542.complete
Subject Subject Range Query Range Percent Splice Strand
CG7789-RA 43..1130 1..1088 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:10:16 Download gff for LD34542.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29803238..29803680 1..443 100 -> Plus
3R 29803745..29804389 444..1088 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:10:16 Download gff for LD34542.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29803238..29803680 1..443 100 -> Plus
3R 29803745..29804389 444..1088 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:10:16 Download gff for LD34542.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29803238..29803680 1..443 100 -> Plus
3R 29803745..29804389 444..1088 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:36:48 Download gff for LD34542.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25628960..25629402 1..443 100 -> Plus
arm_3R 25629467..25630111 444..1088 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:58:06 Download gff for LD34542.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29544069..29544511 1..443 100 -> Plus
3R 29544576..29545220 444..1088 100   Plus

LD34542.hyp Sequence

Translation from 0 to 984

> LD34542.hyp
KHLIPILKRSPASLSHTNKITMAATAPVIMRVMASSISTAKRAGGIIRDV
LKKGDLGIVDKGKNDPQTEADRSAQRCIIASLAKKFPTVKIIGEEGGSDL
NVCDDWLVNELDEEFLQHSCPAEWKDVKPEDFVIWVDPLDGTAEYTQGHV
EHVTVLIGIAVKDAAVGGIIHQPFYQQPDGEMGRTIWGLKGLGTGGFTAV
PAPAGQFIITTTRSHSNALHQQALNAFASTEVLKVGGAGFKVLQLLEGKA
HAYVFATPGCKKWDTCAPEAVLEAQGGCLTNINGEHYAYNADVEHVNRQG
VLASLGQDHAALVEKIPAEVRAAVGAK*

LD34542.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:21:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG7789-PA 306 CG7789-PA 1..306 22..327 1601 100 Plus
CG15743-PB 355 CG15743-PB 57..343 29..316 360 33.1 Plus
CG15743-PC 355 CG15743-PC 57..343 29..316 360 33.1 Plus
CG15743-PA 355 CG15743-PA 57..343 29..316 360 33.1 Plus
Ipp-PA 375 CG3028-PA 159..319 134..277 157 27.4 Plus

LD34542.pep Sequence

Translation from 64 to 984

> LD34542.pep
MAATAPVIMRVMASSISTAKRAGGIIRDVLKKGDLGIVDKGKNDPQTEAD
RSAQRCIIASLAKKFPTVKIIGEEGGSDLNVCDDWLVNELDEEFLQHSCP
AEWKDVKPEDFVIWVDPLDGTAEYTQGHVEHVTVLIGIAVKDAAVGGIIH
QPFYQQPDGEMGRTIWGLKGLGTGGFTAVPAPAGQFIITTTRSHSNALHQ
QALNAFASTEVLKVGGAGFKVLQLLEGKAHAYVFATPGCKKWDTCAPEAV
LEAQGGCLTNINGEHYAYNADVEHVNRQGVLASLGQDHAALVEKIPAEVR
AAVGAK*

LD34542.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:34:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18667-PA 304 GF18667-PA 2..304 4..306 1448 89.4 Plus
Dana\GF20869-PA 352 GF20869-PA 52..350 8..306 369 34 Plus
Dana\GF16228-PA 374 GF16228-PA 149..318 104..256 166 28.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:34:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11697-PA 306 GG11697-PA 1..306 1..306 1587 97.7 Plus
Dere\GG17765-PA 355 GG17765-PA 57..343 8..295 355 32.8 Plus
Dere\GG19895-PA 374 GG19895-PA 158..318 113..256 160 28.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:34:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19967-PA 306 GH19967-PA 1..304 1..304 1371 82.2 Plus
Dgri\GH12318-PA 348 GH12318-PA 50..338 8..294 389 35 Plus
Dgri\GH14420-PA 374 GH14420-PA 155..315 113..256 171 29.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:38:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG7789-PA 306 CG7789-PA 1..306 1..306 1601 100 Plus
CG15743-PB 355 CG15743-PB 57..343 8..295 360 33.1 Plus
CG15743-PC 355 CG15743-PC 57..343 8..295 360 33.1 Plus
CG15743-PA 355 CG15743-PA 57..343 8..295 360 33.1 Plus
Ipp-PA 375 CG3028-PA 159..319 113..256 157 27.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:34:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22044-PA 308 GI22044-PA 1..306 1..306 1365 82 Plus
Dmoj\GI21462-PA 348 GI21462-PA 50..336 8..295 382 34.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:34:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23516-PA 305 GL23516-PA 1..304 1..304 1435 87.8 Plus
Dper\GL13412-PA 210 GL13412-PA 63..210 8..153 183 31.8 Plus
Dper\GL13413-PA 139 GL13413-PA 20..117 187..284 171 41.4 Plus
Dper\GL24229-PA 372 GL24229-PA 158..318 113..256 163 29.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:34:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20589-PA 305 GA20589-PA 1..304 1..304 1438 87.8 Plus
Dpse\GA13929-PA 350 GA13929-PA 52..328 8..284 367 34 Plus
Dpse\GA15747-PA 372 GA15747-PA 158..345 113..287 164 28.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:34:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12826-PA 306 GM12826-PA 1..306 1..306 1595 98.7 Plus
Dsec\GM11612-PA 355 GM11612-PA 57..343 8..295 357 33.1 Plus
Dsec\GM24144-PA 373 GM24144-PA 157..317 113..256 160 28.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:34:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21468-PA 167 GD21468-PA 1..167 1..167 874 98.8 Plus
Dsim\GD21469-PA 138 GD21469-PA 1..138 169..306 721 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:34:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24097-PA 306 GJ24097-PA 1..305 1..305 1365 82.6 Plus
Dvir\GJ16483-PA 348 GJ16483-PA 50..336 8..295 368 34.4 Plus
Dvir\GJ22570-PA 376 GJ22570-PA 155..324 113..263 170 29.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:34:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11929-PA 313 GK11929-PA 4..313 2..306 1320 79.4 Plus
Dwil\GK25305-PA 349 GK25305-PA 52..337 8..295 364 33.2 Plus
Dwil\GK22680-PA 372 GK22680-PA 147..320 100..256 156 28.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:34:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23887-PA 306 GE23887-PA 1..306 1..306 1589 98 Plus
Dyak\GE17055-PA 355 GE17055-PA 57..343 8..295 359 33 Plus
Dyak\GE26306-PA 488 GE26306-PA 272..432 113..256 159 28.5 Plus