Clone LD35121 Report

Search the DGRC for LD35121

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:351
Well:21
Vector:pOT2
Associated Gene/TranscriptCG5039-RA
Protein status:LD35121.pep: gold
Preliminary Size:580
Sequenced Size:710

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5039 2002-01-01 Sim4 clustering to Release 2
CG5039 2002-05-18 Blastp of sequenced clone
CG5039 2003-01-01 Sim4 clustering to Release 3
CG5039 2008-04-29 Release 5.5 accounting
CG5039 2008-08-15 Release 5.9 accounting
CG5039 2008-12-18 5.12 accounting

Clone Sequence Records

LD35121.complete Sequence

710 bp (710 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118953

> LD35121.complete
CTGAAATTTTTGAGAACTTTTTGCTTCGTAGTTGTTGTGATTTCTTTGTA
CATCCCCTGAAAACGATGAAGTTACTTGAGCCTCAGACGACCATTAGTCC
TGAACCGGACATACTGCATCCGGACGACGGTCAATACATATGGCTGCCAA
TTTCCGTGCTCGTTGGCATTTTCGTTCTGGCTGCACTGGTCTACGCCATG
TCACGTAGTCGCTGTCGGAATTCCTGGGATTGCCTAAAGAGCAGGAAGGC
TCCGCGAAGTGGATACATCAATGTGGATGAGGAGGATTCCGATGTGCCCA
TGGACTGCGGAGATGAACTGGGAGATCAAAGGACTACTGCTACTCTCCTC
ACTGGTCGCCTCCACATTCAGGATGGAGCGAATAACGCCTCCAATGCCTA
GTGAATCTCAAAAGTCTTCCATACACTTTATTGTCCACGTTGTCTTCAAA
CGGTGGTTGTCATCGGTTTAGTTACTACTGCAAACTACGTGCCTCTACTA
CAAGTACAACGAAAATAACCCTAATTTTAATGATCCGTACTGGTGGCGCC
AAGGATTCGCGTCGTCAGGTCGTAGAAGCCAAAGAAGAATGCACCGCCCA
GTGTGATCCACAGCACACGCGGCACAAAGCCAGCAAACAGACTGAAAAGT
AACATCGAAGTACATTAATAAATGTAATAAATAGTTTTGTAAAAAAAAAA
AAAAAAAAAA

LD35121.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:02:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG5039-RA 720 CG5039-RA 29..720 1..692 3460 100 Plus
CG4743-RA 1199 CG4743-RA 951..1199 642..394 1245 100 Minus
CG4743-RB 1215 CG4743-RB 967..1215 642..394 1245 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:19:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 21502248..21502563 375..690 1580 100 Plus
chr3R 27901430 chr3R 21501746..21501935 1..190 950 100 Plus
chr3R 27901430 chr3R 21502002..21502193 184..375 945 99.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:29:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:19:58
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25679214..25679532 375..693 1595 100 Plus
3R 32079331 3R 25678712..25678901 1..190 950 100 Plus
3R 32079331 3R 25678968..25679159 184..375 945 99.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:34:35
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 25420045..25420363 375..693 1595 100 Plus
3R 31820162 3R 25419543..25419732 1..190 950 100 Plus
3R 31820162 3R 25419799..25419990 184..375 945 99.4 Plus
Blast to na_te.dros performed on 2019-03-16 04:19:58 has no hits.

LD35121.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:21:01 Download gff for LD35121.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 21501746..21501933 1..188 100 -> Plus
chr3R 21502007..21502192 189..374 100 -> Plus
chr3R 21502248..21502563 375..690 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:17:08 Download gff for LD35121.complete
Subject Subject Range Query Range Percent Splice Strand
CG5039-RA 1..336 66..401 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:44:14 Download gff for LD35121.complete
Subject Subject Range Query Range Percent Splice Strand
CG5039-RA 1..336 66..401 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:25:12 Download gff for LD35121.complete
Subject Subject Range Query Range Percent Splice Strand
CG5039-RA 1..336 66..401 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:36:24 Download gff for LD35121.complete
Subject Subject Range Query Range Percent Splice Strand
CG5039-RA 1..336 66..401 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:35:04 Download gff for LD35121.complete
Subject Subject Range Query Range Percent Splice Strand
CG5039-RA 1..336 66..401 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:19:08 Download gff for LD35121.complete
Subject Subject Range Query Range Percent Splice Strand
CG5039-RA 1..621 1..621 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:44:13 Download gff for LD35121.complete
Subject Subject Range Query Range Percent Splice Strand
CG5039-RA 1..690 1..690 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:25:12 Download gff for LD35121.complete
Subject Subject Range Query Range Percent Splice Strand
CG5039-RA 30..719 1..690 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:36:24 Download gff for LD35121.complete
Subject Subject Range Query Range Percent Splice Strand
CG5039-RA 1..621 1..621 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:35:04 Download gff for LD35121.complete
Subject Subject Range Query Range Percent Splice Strand
CG5039-RA 30..719 1..690 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:21:01 Download gff for LD35121.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25678973..25679158 189..374 100 -> Plus
3R 25678712..25678899 1..188 100 -> Plus
3R 25679214..25679529 375..690 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:21:01 Download gff for LD35121.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25678973..25679158 189..374 100 -> Plus
3R 25678712..25678899 1..188 100 -> Plus
3R 25679214..25679529 375..690 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:21:01 Download gff for LD35121.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25678973..25679158 189..374 100 -> Plus
3R 25678712..25678899 1..188 100 -> Plus
3R 25679214..25679529 375..690 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:25:12 Download gff for LD35121.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21504695..21504880 189..374 100 -> Plus
arm_3R 21504936..21505251 375..690 100   Plus
arm_3R 21504434..21504621 1..188 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:08:48 Download gff for LD35121.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25420045..25420360 375..690 100   Plus
3R 25419543..25419730 1..188 100 -> Plus
3R 25419804..25419989 189..374 100 -> Plus

LD35121.hyp Sequence

Translation from 2 to 400

> LD35121.hyp
EIFENFLLRSCCDFFVHPLKTMKLLEPQTTISPEPDILHPDDGQYIWLPI
SVLVGIFVLAALVYAMSRSRCRNSWDCLKSRKAPRSGYINVDEEDSDVPM
DCGDELGDQRTTATLLTGRLHIQDGANNASNA*

LD35121.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:01:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG5039-PA 111 CG5039-PA 1..111 22..132 587 100 Plus

LD35121.pep Sequence

Translation from 65 to 400

> LD35121.pep
MKLLEPQTTISPEPDILHPDDGQYIWLPISVLVGIFVLAALVYAMSRSRC
RNSWDCLKSRKAPRSGYINVDEEDSDVPMDCGDELGDQRTTATLLTGRLH
IQDGANNASNA*

LD35121.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:18:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16767-PA 106 GF16767-PA 8..106 8..111 400 74 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:18:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11420-PA 111 GG11420-PA 1..111 1..111 523 89.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:18:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18987-PA 115 GH18987-PA 5..100 6..101 192 51 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:29:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG5039-PA 111 CG5039-PA 1..111 1..111 587 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:18:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22414-PA 121 GI22414-PA 3..96 4..102 175 55.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:18:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21528-PA 113 GL21528-PA 6..101 8..103 349 67.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:18:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26316-PA 113 GA26316-PA 6..101 8..103 354 68.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:18:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10260-PA 111 GM10260-PA 1..111 1..111 541 91 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:18:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21231-PA 111 GD21231-PA 1..111 1..111 542 91.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:18:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10974-PA 98 GJ10974-PA 3..76 4..79 241 65.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:18:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12855-PA 125 GK12855-PA 1..106 1..101 319 63.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:18:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23615-PA 112 GE23615-PA 4..112 3..111 498 86.2 Plus