BDGP Sequence Production Resources |
Search the DGRC for LD35121
Library: | LD |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Ling Hong |
Date Registered: | 1997-12-04 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 351 |
Well: | 21 |
Vector: | pOT2 |
Associated Gene/Transcript | CG5039-RA |
Protein status: | LD35121.pep: gold |
Preliminary Size: | 580 |
Sequenced Size: | 710 |
Gene | Date | Evidence |
---|---|---|
CG5039 | 2002-01-01 | Sim4 clustering to Release 2 |
CG5039 | 2002-05-18 | Blastp of sequenced clone |
CG5039 | 2003-01-01 | Sim4 clustering to Release 3 |
CG5039 | 2008-04-29 | Release 5.5 accounting |
CG5039 | 2008-08-15 | Release 5.9 accounting |
CG5039 | 2008-12-18 | 5.12 accounting |
710 bp (710 high quality bases) assembled on 2002-05-18
GenBank Submission: AY118953
> LD35121.complete CTGAAATTTTTGAGAACTTTTTGCTTCGTAGTTGTTGTGATTTCTTTGTA CATCCCCTGAAAACGATGAAGTTACTTGAGCCTCAGACGACCATTAGTCC TGAACCGGACATACTGCATCCGGACGACGGTCAATACATATGGCTGCCAA TTTCCGTGCTCGTTGGCATTTTCGTTCTGGCTGCACTGGTCTACGCCATG TCACGTAGTCGCTGTCGGAATTCCTGGGATTGCCTAAAGAGCAGGAAGGC TCCGCGAAGTGGATACATCAATGTGGATGAGGAGGATTCCGATGTGCCCA TGGACTGCGGAGATGAACTGGGAGATCAAAGGACTACTGCTACTCTCCTC ACTGGTCGCCTCCACATTCAGGATGGAGCGAATAACGCCTCCAATGCCTA GTGAATCTCAAAAGTCTTCCATACACTTTATTGTCCACGTTGTCTTCAAA CGGTGGTTGTCATCGGTTTAGTTACTACTGCAAACTACGTGCCTCTACTA CAAGTACAACGAAAATAACCCTAATTTTAATGATCCGTACTGGTGGCGCC AAGGATTCGCGTCGTCAGGTCGTAGAAGCCAAAGAAGAATGCACCGCCCA GTGTGATCCACAGCACACGCGGCACAAAGCCAGCAAACAGACTGAAAAGT AACATCGAAGTACATTAATAAATGTAATAAATAGTTTTGTAAAAAAAAAA AAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 21502248..21502563 | 375..690 | 1580 | 100 | Plus |
chr3R | 27901430 | chr3R | 21501746..21501935 | 1..190 | 950 | 100 | Plus |
chr3R | 27901430 | chr3R | 21502002..21502193 | 184..375 | 945 | 99.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 25679214..25679532 | 375..693 | 1595 | 100 | Plus |
3R | 32079331 | 3R | 25678712..25678901 | 1..190 | 950 | 100 | Plus |
3R | 32079331 | 3R | 25678968..25679159 | 184..375 | 945 | 99.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 25420045..25420363 | 375..693 | 1595 | 100 | Plus |
3R | 31820162 | 3R | 25419543..25419732 | 1..190 | 950 | 100 | Plus |
3R | 31820162 | 3R | 25419799..25419990 | 184..375 | 945 | 99.4 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 21501746..21501933 | 1..188 | 100 | -> | Plus |
chr3R | 21502007..21502192 | 189..374 | 100 | -> | Plus |
chr3R | 21502248..21502563 | 375..690 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5039-RA | 1..336 | 66..401 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5039-RA | 1..336 | 66..401 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5039-RA | 1..336 | 66..401 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5039-RA | 1..336 | 66..401 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5039-RA | 1..336 | 66..401 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5039-RA | 1..621 | 1..621 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5039-RA | 1..690 | 1..690 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5039-RA | 30..719 | 1..690 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5039-RA | 1..621 | 1..621 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG5039-RA | 30..719 | 1..690 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 25678973..25679158 | 189..374 | 100 | -> | Plus |
3R | 25678712..25678899 | 1..188 | 100 | -> | Plus |
3R | 25679214..25679529 | 375..690 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 25678973..25679158 | 189..374 | 100 | -> | Plus |
3R | 25678712..25678899 | 1..188 | 100 | -> | Plus |
3R | 25679214..25679529 | 375..690 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 25678973..25679158 | 189..374 | 100 | -> | Plus |
3R | 25678712..25678899 | 1..188 | 100 | -> | Plus |
3R | 25679214..25679529 | 375..690 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 21504695..21504880 | 189..374 | 100 | -> | Plus |
arm_3R | 21504936..21505251 | 375..690 | 100 | Plus | |
arm_3R | 21504434..21504621 | 1..188 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 25420045..25420360 | 375..690 | 100 | Plus | |
3R | 25419543..25419730 | 1..188 | 100 | -> | Plus |
3R | 25419804..25419989 | 189..374 | 100 | -> | Plus |
Translation from 2 to 400
> LD35121.hyp EIFENFLLRSCCDFFVHPLKTMKLLEPQTTISPEPDILHPDDGQYIWLPI SVLVGIFVLAALVYAMSRSRCRNSWDCLKSRKAPRSGYINVDEEDSDVPM DCGDELGDQRTTATLLTGRLHIQDGANNASNA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG5039-PA | 111 | CG5039-PA | 1..111 | 22..132 | 587 | 100 | Plus |
Translation from 65 to 400
> LD35121.pep MKLLEPQTTISPEPDILHPDDGQYIWLPISVLVGIFVLAALVYAMSRSRC RNSWDCLKSRKAPRSGYINVDEEDSDVPMDCGDELGDQRTTATLLTGRLH IQDGANNASNA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF16767-PA | 106 | GF16767-PA | 8..106 | 8..111 | 400 | 74 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG11420-PA | 111 | GG11420-PA | 1..111 | 1..111 | 523 | 89.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18987-PA | 115 | GH18987-PA | 5..100 | 6..101 | 192 | 51 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG5039-PA | 111 | CG5039-PA | 1..111 | 1..111 | 587 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI22414-PA | 121 | GI22414-PA | 3..96 | 4..102 | 175 | 55.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL21528-PA | 113 | GL21528-PA | 6..101 | 8..103 | 349 | 67.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA26316-PA | 113 | GA26316-PA | 6..101 | 8..103 | 354 | 68.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM10260-PA | 111 | GM10260-PA | 1..111 | 1..111 | 541 | 91 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD21231-PA | 111 | GD21231-PA | 1..111 | 1..111 | 542 | 91.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ10974-PA | 98 | GJ10974-PA | 3..76 | 4..79 | 241 | 65.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK12855-PA | 125 | GK12855-PA | 1..106 | 1..101 | 319 | 63.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE23615-PA | 112 | GE23615-PA | 4..112 | 3..111 | 498 | 86.2 | Plus |