Clone LD35371 Report

Search the DGRC for LD35371

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:353
Well:71
Vector:pOT2
Associated Gene/TranscriptmRpS7-RA
Protein status:LD35371.pep: gold
Preliminary Size:992
Sequenced Size:807

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5108 2001-01-01 Release 2 assignment
CG5108 2003-01-01 Sim4 clustering to Release 3
CG5108 2003-01-13 Blastp of sequenced clone
mRpS7 2008-04-29 Release 5.5 accounting
mRpS7 2008-08-15 Release 5.9 accounting
mRpS7 2008-12-18 5.12 accounting

Clone Sequence Records

LD35371.complete Sequence

807 bp (807 high quality bases) assembled on 2003-01-13

GenBank Submission: AY075413

> LD35371.complete
TATATGCATGCCGCAAATGTGCATAACATATATATAACATAGTTTTTTTA
TTTTTTGCCGACACAGCAGACGATGTAAACATGTCGCTTTTAGGTAGGAT
TGCAGAGAAAACTTCAAGGCTCAGCTGCCTTCGATTGATGTCGGTGTATC
CCACACACTATGTCGAACCAATTGTACAAAAATATAAACAACTAGAGCAA
AAGAATGATCTGTCCAAGCTTTACCATGTGCCCATCAAGGCGGCGGTCAA
CAAATCGTCTGATACCATCTTTCACGACGATACAAAACATAAAATGATCA
ATTATATAACGAAAAAGGGGAACAGTGCCTTGGCCAGAACGCTTTTGTCC
AAGACGCTGGAGCTAATAAAACGAACCCAGACGGAGCACATGAATCTGGC
CAAAGGGGAGAAGACAACCATAAACACCAATCCCGAAACGCTTCTGAAAC
AAGCGGTTGAAAACTGCCGACCGCTCCTTCAAGTGACCGCCATAAAACGT
GGTGGTGTCACCTATCAAGTCCCTGTTCCCATCACCACGAAGCGGTCATA
TTTTCTGGCCATGAAGTGGCTCTTGGAAGCTGCCCGCGAGAAGGAGCGTA
AGGTGTCCCTGCCGGAAAAGTTGGCCTGGGAGATTCTCGACGCAGCCCAT
GGCCAGGGAAGGGTCATCAAGCGAAAGGACGATCTGCACAGGCTGTGCGA
AAGCAACCGCGCCTACGCACATTACCGATGGAGCTAAATGCACAACAAAC
TGTTTTTCCAATGCAATAAACTTTTCATATACCTGTTAAAAAAAAAAAAA
AAAAAAA

LD35371.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:27:48
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS7-RA 994 mRpS7-RA 52..840 1..789 3945 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:56:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 10385719..10386383 123..787 3325 100 Plus
chr2L 23010047 chr2L 10385523..10385646 1..124 620 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:29:55 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:56:23
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10386860..10387526 123..789 3335 100 Plus
2L 23513712 2L 10386664..10386787 1..124 620 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:04:33
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10386860..10387526 123..789 3335 100 Plus
2L 23513712 2L 10386664..10386787 1..124 620 100 Plus
Blast to na_te.dros performed on 2019-03-16 10:56:24 has no hits.

LD35371.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:57:18 Download gff for LD35371.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 10385523..10385646 1..124 100 -> Plus
chr2L 10385721..10386383 125..787 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:17:35 Download gff for LD35371.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS7-RA 1..657 81..737 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:58:31 Download gff for LD35371.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS7-RA 1..657 81..737 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:34:51 Download gff for LD35371.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS7-RA 1..657 81..737 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:49:18 Download gff for LD35371.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS7-RA 1..657 81..737 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:20:55 Download gff for LD35371.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS7-RA 1..657 81..737 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:15:07 Download gff for LD35371.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS7-RA 1..787 1..787 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:58:30 Download gff for LD35371.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS7-RA 1..787 1..787 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:34:51 Download gff for LD35371.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS7-RA 3..789 1..787 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:49:18 Download gff for LD35371.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS7-RA 1..787 1..787 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:20:55 Download gff for LD35371.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS7-RA 3..789 1..787 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:57:18 Download gff for LD35371.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10386664..10386787 1..124 100 -> Plus
2L 10386862..10387524 125..787 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:57:18 Download gff for LD35371.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10386664..10386787 1..124 100 -> Plus
2L 10386862..10387524 125..787 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:57:18 Download gff for LD35371.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10386664..10386787 1..124 100 -> Plus
2L 10386862..10387524 125..787 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:34:51 Download gff for LD35371.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10386664..10386787 1..124 100 -> Plus
arm_2L 10386862..10387524 125..787 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:20:46 Download gff for LD35371.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10386862..10387524 125..787 100   Plus
2L 10386664..10386787 1..124 100 -> Plus

LD35371.pep Sequence

Translation from 80 to 736

> LD35371.pep
MSLLGRIAEKTSRLSCLRLMSVYPTHYVEPIVQKYKQLEQKNDLSKLYHV
PIKAAVNKSSDTIFHDDTKHKMINYITKKGNSALARTLLSKTLELIKRTQ
TEHMNLAKGEKTTINTNPETLLKQAVENCRPLLQVTAIKRGGVTYQVPVP
ITTKRSYFLAMKWLLEAAREKERKVSLPEKLAWEILDAAHGQGRVIKRKD
DLHRLCESNRAYAHYRWS*

LD35371.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:24:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15778-PA 218 GF15778-PA 1..218 1..218 986 83 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:24:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10121-PA 217 GG10121-PA 1..217 1..218 1106 96.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:24:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13011-PA 196 GH13011-PA 1..196 20..218 714 65.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:02:01
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS7-PB 218 CG5108-PB 1..218 1..218 1124 100 Plus
mRpS7-PA 218 CG5108-PA 1..218 1..218 1124 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:24:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18294-PA 218 GM18294-PA 1..218 1..218 1120 96.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:24:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23690-PA 218 GD23690-PA 1..218 1..218 1130 97.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:24:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15410-PA 58 GJ15410-PA 1..58 161..218 287 89.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:24:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18609-PA 146 GK18609-PA 1..146 72..218 555 69.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:24:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18935-PA 218 GE18935-PA 1..218 1..218 1117 95.9 Plus

LD35371.hyp Sequence

Translation from 80 to 736

> LD35371.hyp
MSLLGRIAEKTSRLSCLRLMSVYPTHYVEPIVQKYKQLEQKNDLSKLYHV
PIKAAVNKSSDTIFHDDTKHKMINYITKKGNSALARTLLSKTLELIKRTQ
TEHMNLAKGEKTTINTNPETLLKQAVENCRPLLQVTAIKRGGVTYQVPVP
ITTKRSYFLAMKWLLEAAREKERKVSLPEKLAWEILDAAHGQGRVIKRKD
DLHRLCESNRAYAHYRWS*

LD35371.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:30:21
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS7-PB 218 CG5108-PB 1..218 1..218 1124 100 Plus
mRpS7-PA 218 CG5108-PA 1..218 1..218 1124 100 Plus