LD35371.complete Sequence
807 bp (807 high quality bases) assembled on 2003-01-13
GenBank Submission: AY075413
> LD35371.complete
TATATGCATGCCGCAAATGTGCATAACATATATATAACATAGTTTTTTTA
TTTTTTGCCGACACAGCAGACGATGTAAACATGTCGCTTTTAGGTAGGAT
TGCAGAGAAAACTTCAAGGCTCAGCTGCCTTCGATTGATGTCGGTGTATC
CCACACACTATGTCGAACCAATTGTACAAAAATATAAACAACTAGAGCAA
AAGAATGATCTGTCCAAGCTTTACCATGTGCCCATCAAGGCGGCGGTCAA
CAAATCGTCTGATACCATCTTTCACGACGATACAAAACATAAAATGATCA
ATTATATAACGAAAAAGGGGAACAGTGCCTTGGCCAGAACGCTTTTGTCC
AAGACGCTGGAGCTAATAAAACGAACCCAGACGGAGCACATGAATCTGGC
CAAAGGGGAGAAGACAACCATAAACACCAATCCCGAAACGCTTCTGAAAC
AAGCGGTTGAAAACTGCCGACCGCTCCTTCAAGTGACCGCCATAAAACGT
GGTGGTGTCACCTATCAAGTCCCTGTTCCCATCACCACGAAGCGGTCATA
TTTTCTGGCCATGAAGTGGCTCTTGGAAGCTGCCCGCGAGAAGGAGCGTA
AGGTGTCCCTGCCGGAAAAGTTGGCCTGGGAGATTCTCGACGCAGCCCAT
GGCCAGGGAAGGGTCATCAAGCGAAAGGACGATCTGCACAGGCTGTGCGA
AAGCAACCGCGCCTACGCACATTACCGATGGAGCTAAATGCACAACAAAC
TGTTTTTCCAATGCAATAAACTTTTCATATACCTGTTAAAAAAAAAAAAA
AAAAAAA
LD35371.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 18:27:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
mRpS7-RA | 994 | mRpS7-RA | 52..840 | 1..789 | 3945 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:56:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 10385719..10386383 | 123..787 | 3325 | 100 | Plus |
chr2L | 23010047 | chr2L | 10385523..10385646 | 1..124 | 620 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:29:55 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:56:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 10386860..10387526 | 123..789 | 3335 | 100 | Plus |
2L | 23513712 | 2L | 10386664..10386787 | 1..124 | 620 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:04:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 10386860..10387526 | 123..789 | 3335 | 100 | Plus |
2L | 23513712 | 2L | 10386664..10386787 | 1..124 | 620 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 10:56:24 has no hits.
LD35371.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:57:18 Download gff for
LD35371.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 10385523..10385646 | 1..124 | 100 | -> | Plus |
chr2L | 10385721..10386383 | 125..787 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:17:35 Download gff for
LD35371.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
mRpS7-RA | 1..657 | 81..737 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:58:31 Download gff for
LD35371.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
mRpS7-RA | 1..657 | 81..737 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:34:51 Download gff for
LD35371.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
mRpS7-RA | 1..657 | 81..737 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:49:18 Download gff for
LD35371.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
mRpS7-RA | 1..657 | 81..737 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:20:55 Download gff for
LD35371.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
mRpS7-RA | 1..657 | 81..737 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:15:07 Download gff for
LD35371.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
mRpS7-RA | 1..787 | 1..787 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:58:30 Download gff for
LD35371.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
mRpS7-RA | 1..787 | 1..787 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:34:51 Download gff for
LD35371.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
mRpS7-RA | 3..789 | 1..787 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:49:18 Download gff for
LD35371.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
mRpS7-RA | 1..787 | 1..787 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:20:55 Download gff for
LD35371.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
mRpS7-RA | 3..789 | 1..787 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:57:18 Download gff for
LD35371.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 10386664..10386787 | 1..124 | 100 | -> | Plus |
2L | 10386862..10387524 | 125..787 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:57:18 Download gff for
LD35371.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 10386664..10386787 | 1..124 | 100 | -> | Plus |
2L | 10386862..10387524 | 125..787 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:57:18 Download gff for
LD35371.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 10386664..10386787 | 1..124 | 100 | -> | Plus |
2L | 10386862..10387524 | 125..787 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:34:51 Download gff for
LD35371.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 10386664..10386787 | 1..124 | 100 | -> | Plus |
arm_2L | 10386862..10387524 | 125..787 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:20:46 Download gff for
LD35371.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 10386862..10387524 | 125..787 | 100 | | Plus |
2L | 10386664..10386787 | 1..124 | 100 | -> | Plus |
LD35371.pep Sequence
Translation from 80 to 736
> LD35371.pep
MSLLGRIAEKTSRLSCLRLMSVYPTHYVEPIVQKYKQLEQKNDLSKLYHV
PIKAAVNKSSDTIFHDDTKHKMINYITKKGNSALARTLLSKTLELIKRTQ
TEHMNLAKGEKTTINTNPETLLKQAVENCRPLLQVTAIKRGGVTYQVPVP
ITTKRSYFLAMKWLLEAAREKERKVSLPEKLAWEILDAAHGQGRVIKRKD
DLHRLCESNRAYAHYRWS*
LD35371.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:24:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF15778-PA | 218 | GF15778-PA | 1..218 | 1..218 | 986 | 83 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:24:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG10121-PA | 217 | GG10121-PA | 1..217 | 1..218 | 1106 | 96.3 | Plus |
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:24:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dgri\GH13011-PA | 196 | GH13011-PA | 1..196 | 20..218 | 714 | 65.3 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:02:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
mRpS7-PB | 218 | CG5108-PB | 1..218 | 1..218 | 1124 | 100 | Plus |
mRpS7-PA | 218 | CG5108-PA | 1..218 | 1..218 | 1124 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:24:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM18294-PA | 218 | GM18294-PA | 1..218 | 1..218 | 1120 | 96.3 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:24:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD23690-PA | 218 | GD23690-PA | 1..218 | 1..218 | 1130 | 97.2 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:24:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ15410-PA | 58 | GJ15410-PA | 1..58 | 161..218 | 287 | 89.7 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:24:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK18609-PA | 146 | GK18609-PA | 1..146 | 72..218 | 555 | 69.4 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:24:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE18935-PA | 218 | GE18935-PA | 1..218 | 1..218 | 1117 | 95.9 | Plus |
LD35371.hyp Sequence
Translation from 80 to 736
> LD35371.hyp
MSLLGRIAEKTSRLSCLRLMSVYPTHYVEPIVQKYKQLEQKNDLSKLYHV
PIKAAVNKSSDTIFHDDTKHKMINYITKKGNSALARTLLSKTLELIKRTQ
TEHMNLAKGEKTTINTNPETLLKQAVENCRPLLQVTAIKRGGVTYQVPVP
ITTKRSYFLAMKWLLEAAREKERKVSLPEKLAWEILDAAHGQGRVIKRKD
DLHRLCESNRAYAHYRWS*
LD35371.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:30:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
mRpS7-PB | 218 | CG5108-PB | 1..218 | 1..218 | 1124 | 100 | Plus |
mRpS7-PA | 218 | CG5108-PA | 1..218 | 1..218 | 1124 | 100 | Plus |