Clone LD35517 Report

Search the DGRC for LD35517

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:355
Well:17
Vector:pOT2
Associated Gene/TranscriptEndoG-RA
Protein status:LD35517.pep: gold
Preliminary Size:1251
Sequenced Size:1123

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8862 2001-01-01 Release 2 assignment
CG8862 2002-03-19 Blastp of sequenced clone
CG8862 2003-01-01 Sim4 clustering to Release 3
CG8862 2008-04-29 Release 5.5 accounting
CG8862 2008-08-15 Release 5.9 accounting
CG8862 2008-12-18 5.12 accounting

Clone Sequence Records

LD35517.complete Sequence

1123 bp (1123 high quality bases) assembled on 2002-03-19

GenBank Submission: AY094821

> LD35517.complete
TGCAATAGCGGTCGCTATCTGGTCTTTTTGTCCAGATTTTTAAATAAAAC
TGCCAAAATGAGTGCTCCTCGAGTGGGTGGCGTATTAGCTTTGGGTGCCA
CCGCCCTGGGCGCCTTTTATCTGGGCACCCACGTGGAACGCGAACGCCAG
CACAATGGCTCCACAAGTGGCCTTCCGCGGCTGCCTGGTCTGCCCACCTT
TGGAACTGTTTCGGCTGCCAGTTTGATTCCCGCCCAAGAGAACAATGTAA
GCTTGACGGCAACTCCGTCTCGGATCGGACAGATCATGAAGTATGGATTT
CCCGGACTCGATCACGTGCGCTCCCATTCGGACTACGTGCTGTCTTACGA
TCGGAGGAACCGGGTGCCCCACTGGGTGTTCGAGCACCTTACGGCAGAGT
CGGTGGCGAAGAACGATGCCGTGGACAGATCGAAGTGCGATTTCAAGCAG
GACGAGAGCATCCATCCGTTCTTCAGGTCACAGAACACGGACTACCGACG
ATCGGGCTATGATCGCGGGCACATGGCCGCCGCTGGAAATCACCGACTGC
ACCAGAAGCACTGCGACGAAACCTTCTACCTATCGAACATGGCGCCACAG
GTGGGCCAGGGCTTCAACCGGGATGCCTGGAACACGCTGGAGGCACACGT
GCGCAGACTGACCAAGACCTACTCCAATGTGTACGTCTGTACGGGTCCAC
TGTACCTACCGCACAAGGAGGACGATGGGAAATCGTATGTCAAGTACGAG
GTCATCGGCGCCAACACCGTGGCTGTTCCCACCCACTTCTACAAGGTTAT
TGTGGGCGAGTCCGCGGACCACAAACTCCACATGGAGTCGTACGTGATGC
CCAATCAGGTGATCAGCAACGACACTCCCATCAGTGTGTTTCAGGTGCCG
CCAGAGAGCGTGGAACGCTCGGCGGGATTGCTCTTCTTCGATCAAATCAA
TCGCAAGCAGCTAACCACCATCAATGGCAAGAAAGTCTAGTCGATGTCTT
AGTTTCGTTTTAGTGTATTTGAACAGGGATAGCCCCTTGTTTAATGTAAT
TTTCTTCTTTTCCAAAGAACTTGTGGATTAATAAAATTAAACAATTAATA
CAAAAAAAAAAAAAAAAAAAAAA

LD35517.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:21:06
Subject Length Description Subject Range Query Range Score Percent Strand
EndoG-RA 1086 EndoG-RA 1..1086 1..1086 5430 100 Plus
Cct5-RA 2093 Cct5-RA 1985..2093 1102..994 545 100 Minus
Cct5-RB 1763 Cct5-RB 1667..1763 1102..1006 485 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:05:10
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8064645..8065745 1101..1 5505 100 Minus
chr2L 23010047 chr2L 2238478..2238588 634..524 240 81.1 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:30:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:05:08
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12177429..12178530 1102..1 5510 100 Minus
2L 23513712 2L 2238746..2238846 620..520 250 83.2 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:50:35
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12178628..12179729 1102..1 5510 100 Minus
2L 23513712 2L 2238746..2238846 620..520 250 83.1 Minus
2L 23513712 2L 2238974..2239032 389..331 145 83 Minus
Blast to na_te.dros performed on 2019-03-15 16:05:08 has no hits.

LD35517.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:06:23 Download gff for LD35517.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8064645..8065745 1..1101 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:17:45 Download gff for LD35517.complete
Subject Subject Range Query Range Percent Splice Strand
CG8862-RA 1..933 58..990 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:28:22 Download gff for LD35517.complete
Subject Subject Range Query Range Percent Splice Strand
EndoG-RA 1..933 58..990 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:52:11 Download gff for LD35517.complete
Subject Subject Range Query Range Percent Splice Strand
EndoG-RA 1..933 58..990 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:02:49 Download gff for LD35517.complete
Subject Subject Range Query Range Percent Splice Strand
CG8862-RA 1..933 58..990 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:26:13 Download gff for LD35517.complete
Subject Subject Range Query Range Percent Splice Strand
EndoG-RA 1..933 58..990 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:54:51 Download gff for LD35517.complete
Subject Subject Range Query Range Percent Splice Strand
CG8862-RA 1..1086 1..1086 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:28:21 Download gff for LD35517.complete
Subject Subject Range Query Range Percent Splice Strand
EndoG-RA 1..1086 1..1086 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:52:11 Download gff for LD35517.complete
Subject Subject Range Query Range Percent Splice Strand
EndoG-RA 24..1124 1..1101 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:02:49 Download gff for LD35517.complete
Subject Subject Range Query Range Percent Splice Strand
CG8862-RA 1..1086 1..1086 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:26:13 Download gff for LD35517.complete
Subject Subject Range Query Range Percent Splice Strand
EndoG-RA 24..1124 1..1101 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:06:23 Download gff for LD35517.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12177430..12178530 1..1101 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:06:23 Download gff for LD35517.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12177430..12178530 1..1101 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:06:23 Download gff for LD35517.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12177430..12178530 1..1101 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:52:11 Download gff for LD35517.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8064935..8066035 1..1101 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:36:15 Download gff for LD35517.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12178629..12179729 1..1101 100   Minus

LD35517.hyp Sequence

Translation from 0 to 989

> LD35517.hyp
CNSGRYLVFLSRFLNKTAKMSAPRVGGVLALGATALGAFYLGTHVERERQ
HNGSTSGLPRLPGLPTFGTVSAASLIPAQENNVSLTATPSRIGQIMKYGF
PGLDHVRSHSDYVLSYDRRNRVPHWVFEHLTAESVAKNDAVDRSKCDFKQ
DESIHPFFRSQNTDYRRSGYDRGHMAAAGNHRLHQKHCDETFYLSNMAPQ
VGQGFNRDAWNTLEAHVRRLTKTYSNVYVCTGPLYLPHKEDDGKSYVKYE
VIGANTVAVPTHFYKVIVGESADHKLHMESYVMPNQVISNDTPISVFQVP
PESVERSAGLLFFDQINRKQLTTINGKKV*

LD35517.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:09:26
Subject Length Description Subject Range Query Range Score Percent Strand
EndoG-PA 310 CG8862-PA 1..310 20..329 1647 100 Plus
Tengl2-PA 318 CG32463-PA 15..302 27..321 675 47.8 Plus
Tengl4-PA 378 CG4683-PA 133..364 92..321 398 36.1 Plus
Tengl1-PA 319 CG31682-PA 1..280 20..323 260 27.1 Plus
Tengl3-PA 337 CG31679-PA 102..292 86..312 218 28.4 Plus

LD35517.pep Sequence

Translation from 57 to 989

> LD35517.pep
MSAPRVGGVLALGATALGAFYLGTHVERERQHNGSTSGLPRLPGLPTFGT
VSAASLIPAQENNVSLTATPSRIGQIMKYGFPGLDHVRSHSDYVLSYDRR
NRVPHWVFEHLTAESVAKNDAVDRSKCDFKQDESIHPFFRSQNTDYRRSG
YDRGHMAAAGNHRLHQKHCDETFYLSNMAPQVGQGFNRDAWNTLEAHVRR
LTKTYSNVYVCTGPLYLPHKEDDGKSYVKYEVIGANTVAVPTHFYKVIVG
ESADHKLHMESYVMPNQVISNDTPISVFQVPPESVERSAGLLFFDQINRK
QLTTINGKKV*

LD35517.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:06:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12638-PA 310 GF12638-PA 1..310 1..310 1483 86.1 Plus
Dana\GF15293-PA 317 GF15293-PA 70..305 72..306 683 54.4 Plus
Dana\GF24166-PA 323 GF24166-PA 75..306 73..302 389 36.5 Plus
Dana\GF15292-PA 313 GF15292-PA 4..279 8..304 303 29.7 Plus
Dana\GF15294-PA 338 GF15294-PA 87..292 46..293 238 28.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:06:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22601-PA 310 GG22601-PA 1..310 1..310 1635 96.8 Plus
Dere\GG24541-PA 318 GG24541-PA 13..306 6..306 677 46.5 Plus
Dere\GG17836-PA 379 GG17836-PA 133..361 73..299 398 36.8 Plus
Dere\GG24540-PA 313 GG24540-PA 1..275 1..299 284 27.8 Plus
Dere\GG24543-PA 337 GG24543-PA 68..292 30..293 236 28.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:06:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22148-PA 312 GH22148-PA 1..312 1..310 1298 77.4 Plus
Dgri\GH13792-PA 318 GH13792-PA 10..306 9..306 642 44.9 Plus
Dgri\GH24683-PA 319 GH24683-PA 1..308 1..302 486 36.7 Plus
Dgri\GH12970-PA 306 GH12970-PA 1..286 1..299 247 27 Plus
Dgri\GH13791-PA 306 GH13791-PA 1..286 1..299 247 28.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:20:46
Subject Length Description Subject Range Query Range Score Percent Strand
EndoG-PA 310 CG8862-PA 1..310 1..310 1647 100 Plus
Tengl2-PA 318 CG32463-PA 15..302 8..302 675 47.8 Plus
Tengl4-PA 378 CG4683-PA 133..364 73..302 398 36.1 Plus
Tengl1-PA 319 CG31682-PA 1..280 1..304 260 27.1 Plus
Tengl3-PA 337 CG31679-PA 102..292 67..293 218 28.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:06:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19378-PA 310 GI19378-PA 1..310 1..310 1368 79.9 Plus
Dmoj\GI18045-PA 317 GI18045-PA 15..305 14..306 641 45.4 Plus
Dmoj\GI21664-PA 381 GI21664-PA 133..367 70..302 469 40.7 Plus
Dmoj\GI17193-PA 312 GI17193-PA 1..292 1..304 304 28.3 Plus
Dmoj\GI18046-PA 336 GI18046-PA 94..314 62..306 233 25.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:06:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11082-PA 304 GL11082-PA 1..304 1..310 1421 83.5 Plus
Dper\GL13439-PA 314 GL13439-PA 1..282 1..290 1262 81 Plus
Dper\GL24726-PA 229 GL24726-PA 1..229 77..310 1114 85 Plus
Dper\GL19410-PA 304 GL19410-PA 71..295 72..295 631 53.1 Plus
Dper\GL25109-PA 385 GL25109-PA 137..370 71..302 418 37.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:06:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24605-PA 304 GA24605-PA 1..304 1..310 1418 83.2 Plus
Dpse\GA16923-PA 317 GA16923-PA 70..297 71..297 637 53.3 Plus
Dpse\GA23686-PA 385 GA23686-PA 137..370 71..302 418 37.4 Plus
Dpse\GA22360-PA 506 GA22360-PA 87..289 56..293 186 23.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:06:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20380-PA 310 GM20380-PA 1..310 1..310 1658 98.1 Plus
Dsec\GM18249-PA 316 GM18249-PA 69..304 72..306 685 55.7 Plus
Dsec\GM23913-PA 378 GM23913-PA 88..364 29..302 413 34.2 Plus
Dsec\GM18248-PA 331 GM18248-PA 1..280 1..304 278 29 Plus
Dsec\GM18250-PA 337 GM18250-PA 102..266 67..266 206 28.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:06:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22855-PA 318 GD22855-PA 13..306 6..306 675 46.9 Plus
Dsim\GD18726-PA 378 GD18726-PA 88..364 29..302 414 34.2 Plus
Dsim\GD22854-PA 319 GD22854-PA 1..280 1..304 282 29 Plus
Dsim\GD22856-PA 337 GD22856-PA 102..266 67..266 216 28.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:06:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19936-PA 310 GJ19936-PA 1..310 1..310 1390 80.8 Plus
Dvir\GJ22347-PA 318 GJ22347-PA 10..306 9..306 650 45.8 Plus
Dvir\GJ15788-PA 379 GJ15788-PA 134..368 70..302 483 42.2 Plus
Dvir\GJ22336-PA 310 GJ22336-PA 3..293 1..304 260 25.9 Plus
Dvir\GJ22358-PA 336 GJ22358-PA 102..299 66..298 233 25.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:06:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23216-PA 310 GK23216-PA 9..310 9..310 1367 82.9 Plus
Dwil\GK14992-PA 322 GK14992-PA 74..310 72..306 688 55.3 Plus
Dwil\GK10249-PA 366 GK10249-PA 122..366 67..307 426 35.8 Plus
Dwil\GK15148-PA 300 GK15148-PA 76..279 72..299 239 26.2 Plus
Dwil\GK14993-PA 314 GK14993-PA 87..291 46..293 213 27.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:06:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13469-PA 310 GE13469-PA 1..310 1..310 1622 96.1 Plus
Dyak\GE15178-PA 318 GE15178-PA 13..306 6..306 681 47.2 Plus
Dyak\GE26063-PA 379 GE26063-PA 133..364 73..302 400 36.9 Plus
Dyak\GE15173-PA 320 GE15173-PA 1..281 1..304 273 27 Plus
Dyak\GE15179-PA 332 GE15179-PA 87..287 46..293 221 27.6 Plus