Clone LD35644 Report

Search the DGRC for LD35644

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:356
Well:44
Vector:pOT2
Associated Gene/TranscriptMED31-RA
Protein status:LD35644.pep: gold
Preliminary Size:1266
Sequenced Size:1115

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1057 2001-01-01 Release 2 assignment
CG1057 2003-01-01 Sim4 clustering to Release 3
CG1057 2003-01-14 Blastp of sequenced clone
MED31 2008-04-29 Release 5.5 accounting
MED31 2008-08-15 Release 5.9 accounting
MED31 2008-12-18 5.12 accounting

Clone Sequence Records

LD35644.complete Sequence

1115 bp (1115 high quality bases) assembled on 2003-01-14

GenBank Submission: AY061423

> LD35644.complete
CAACAATCCAAATGAACTCCTACGGTTTGTAGACAATATTAAAAACTGAA
TTTAACTGCCTTCCCACAAGAAATCACCAACACAAAGGGAGCGACAACCC
ACCGCCTGCGCCCAGAAACCTGGTCGACTGTTTTCCCGAGTTTTCTTTTG
GCCCACAACCTGCGTTTGCTCTGTGCAGTCACTGCCGCGCCATACATTTT
ATTTCATTAGCGAAGCCCATATATATTTATAATTTTACTTGTGTGTTTTG
TTTGCCGCGACGTTTCGTTTTCAATTCGATGGTGCACCAAAACACACAGC
TCAGAACATCCACATAGCACACTGAAAGAAACCAAGAACCCAACCCGACA
CCGAAACTGAATAGACGCAAGTACCGACCCAACGAGACCCTTTCCAAAGC
CAAAGACCAGTCCAAAATGGCCAAAATGTACGGAAAGGGTAAGACTGCTA
TCGAGTCGGAGGAGCTGCAGAAGCGACGCTGGCAGATCGAGCTGGAGTTC
GTGCAGTGCCTGTCGAACCCCAACTATCTAAACTTCCTTGCACAGCGTGG
ATTTTTCAAGGACCAGTCGTTCATCAACTACCTGAAGTATCTGCAGTACT
GGAAGGAGCCGGACTATGCGAAATACCTCATGTACCCAATGTGCCTCTAC
TTCCTCGATCTGCTGCAGTACGAACACTTCCGCCGGGAGATCGTCAACTC
GCAGTGCTGCAAGTTCATAGACGACCAGGCCATTCTGCAGTGGCAGCACT
ACACTCGCAAGCGCATCAAACTGATCGAAAACGTTACGGCCGCCCAGCAG
CAACAACAGCAGCTTCAGCAGCAACAACAGCAGGCGAACGGCATGGAGGC
AGCAACGGGAGGCGAATCAGCAGCACCTACCCCCAACGTGAACGGGTCAG
CTTCCACGGCGGATAGTCAACAGACGTCTTCTGCCCTACAGCCTGTCCAA
GCACAGCCTGGAAATCCCCAGCAGCAGCAGCAAATCAATGGCGTGGCATC
GGGGGCCAACATAAAACTAGAGTTAAACTAGCGCTGGCAACTAAAAGTTT
ACCAATAAAATAGTATAAGAACCTGGAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAA

LD35644.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:27:21
Subject Length Description Subject Range Query Range Score Percent Strand
MED31-RA 1182 MED31-RA 45..1122 1..1078 5390 100 Plus
MED31-RB 812 MED31-RB 35..812 299..1076 3890 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:28:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 468461..469002 535..1076 2710 100 Plus
chr3R 27901430 chr3R 467695..468138 1..444 2220 100 Plus
chr3R 27901430 chr3R 468279..468368 445..534 450 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:30:11 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:28:14
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 4642751..4643294 535..1078 2720 100 Plus
3R 32079331 3R 4641985..4642428 1..444 2220 100 Plus
3R 32079331 3R 4642569..4642658 445..534 450 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:04:13
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 4383582..4384125 535..1078 2720 100 Plus
3R 31820162 3R 4382816..4383259 1..444 2220 100 Plus
3R 31820162 3R 4383400..4383489 445..534 450 100 Plus
Blast to na_te.dros performed on 2019-03-15 22:28:15 has no hits.

LD35644.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:28:54 Download gff for LD35644.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 467695..468138 1..444 100 -> Plus
chr3R 468279..468368 445..534 100 -> Plus
chr3R 468461..469002 535..1076 92   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:17:50 Download gff for LD35644.complete
Subject Subject Range Query Range Percent Splice Strand
MED31-RB 1..615 417..1031 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:58:01 Download gff for LD35644.complete
Subject Subject Range Query Range Percent Splice Strand
MED31-RB 1..615 417..1031 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:21:13 Download gff for LD35644.complete
Subject Subject Range Query Range Percent Splice Strand
MED31-RA 1..615 417..1031 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed on 2008-07-21 17:48:50 has no hits.
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:24:01 Download gff for LD35644.complete
Subject Subject Range Query Range Percent Splice Strand
MED31-RA 1..615 417..1031 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:14:27 Download gff for LD35644.complete
Subject Subject Range Query Range Percent Splice Strand
MED31-RA 12..1087 1..1076 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:58:01 Download gff for LD35644.complete
Subject Subject Range Query Range Percent Splice Strand
MED31-RA 12..1087 1..1076 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:21:13 Download gff for LD35644.complete
Subject Subject Range Query Range Percent Splice Strand
MED31-RA 23..1098 1..1076 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:48:50 Download gff for LD35644.complete
Subject Subject Range Query Range Percent Splice Strand
MED31-RA 12..1087 1..1076 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:24:01 Download gff for LD35644.complete
Subject Subject Range Query Range Percent Splice Strand
MED31-RA 23..1098 1..1076 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:28:54 Download gff for LD35644.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4641985..4642428 1..444 100 -> Plus
3R 4642569..4642658 445..534 100 -> Plus
3R 4642751..4643292 535..1076 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:28:54 Download gff for LD35644.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4641985..4642428 1..444 100 -> Plus
3R 4642569..4642658 445..534 100 -> Plus
3R 4642751..4643292 535..1076 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:28:54 Download gff for LD35644.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4641985..4642428 1..444 100 -> Plus
3R 4642569..4642658 445..534 100 -> Plus
3R 4642751..4643292 535..1076 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:21:13 Download gff for LD35644.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 467707..468150 1..444 100 -> Plus
arm_3R 468291..468380 445..534 100 -> Plus
arm_3R 468473..469014 535..1076 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:20:15 Download gff for LD35644.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4382816..4383259 1..444 100 -> Plus
3R 4383400..4383489 445..534 100 -> Plus
3R 4383582..4384123 535..1076 100   Plus

LD35644.hyp Sequence

Translation from 416 to 1030

> LD35644.hyp
MAKMYGKGKTAIESEELQKRRWQIELEFVQCLSNPNYLNFLAQRGFFKDQ
SFINYLKYLQYWKEPDYAKYLMYPMCLYFLDLLQYEHFRREIVNSQCCKF
IDDQAILQWQHYTRKRIKLIENVTAAQQQQQQLQQQQQQANGMEAATGGE
SAAPTPNVNGSASTADSQQTSSALQPVQAQPGNPQQQQQINGVASGANIK
LELN*

LD35644.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:19:54
Subject Length Description Subject Range Query Range Score Percent Strand
MED31-PC 204 CG1057-PC 1..204 1..204 1072 100 Plus
MED31-PB 204 CG1057-PB 1..204 1..204 1072 100 Plus
MED31-PA 204 CG1057-PA 1..204 1..204 1072 100 Plus
MED31-PD 202 CG1057-PD 1..202 1..204 1043 98.5 Plus
MED31-PE 199 CG1057-PE 6..199 11..204 1019 100 Plus

LD35644.pep Sequence

Translation from 416 to 1030

> LD35644.pep
MAKMYGKGKTAIESEELQKRRWQIELEFVQCLSNPNYLNFLAQRGFFKDQ
SFINYLKYLQYWKEPDYAKYLMYPMCLYFLDLLQYEHFRREIVNSQCCKF
IDDQAILQWQHYTRKRIKLIENVTAAQQQQQQLQQQQQQANGMEAATGGE
SAAPTPNVNGSASTADSQQTSSALQPVQAQPGNPQQQQQINGVASGANIK
LELN*

LD35644.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:54:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16664-PA 205 GF16664-PA 1..205 1..204 789 83.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:54:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12516-PA 203 GG12516-PA 1..203 1..204 961 94.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:54:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19496-PA 261 GH19496-PA 1..170 1..175 668 78.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:02:21
Subject Length Description Subject Range Query Range Score Percent Strand
MED31-PC 204 CG1057-PC 1..204 1..204 1072 100 Plus
MED31-PB 204 CG1057-PB 1..204 1..204 1072 100 Plus
MED31-PA 204 CG1057-PA 1..204 1..204 1072 100 Plus
MED31-PD 202 CG1057-PD 1..202 1..204 1043 98.5 Plus
MED31-PE 199 CG1057-PE 6..199 11..204 1019 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:54:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23767-PA 251 GI23767-PA 1..123 1..123 636 92.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:54:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22071-PA 214 GL22071-PA 1..214 1..204 712 75.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:54:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27367-PA 214 GA27367-PA 1..214 1..204 701 74.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:54:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10767-PA 205 GM10767-PA 1..205 1..204 1049 97.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:54:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19742-PA 206 GD19742-PA 1..206 1..204 1055 97.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:54:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23949-PA 248 GJ23949-PA 1..248 1..204 664 66.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:54:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11506-PA 218 GK11506-PA 1..218 1..204 711 74.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:54:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25426-PA 199 GE25426-PA 1..199 1..204 883 91.7 Plus
Dyak\GE14983-PA 79 GE14983-PA 1..39 1..39 209 100 Plus