Clone LD35705 Report

Search the DGRC for LD35705

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:357
Well:5
Vector:pOT2
Associated Gene/TranscriptCycC-RA
Protein status:LD35705.pep: gold
Preliminary Size:1292
Sequenced Size:1131

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7281 2001-01-01 Release 2 assignment
CG7281 2003-01-01 Sim4 clustering to Release 3
CG7281 2003-02-27 Blastp of sequenced clone
CycC 2008-04-29 Release 5.5 accounting
CycC 2008-08-15 Release 5.9 accounting
CycC 2008-12-18 5.12 accounting

Clone Sequence Records

LD35705.complete Sequence

1131 bp (1131 high quality bases) assembled on 2003-02-27

GenBank Submission: AY061425

> LD35705.complete
CAACACAATTTTTTCGTTTTTCCTGGTTTTCCGGCTTGCTATTGAAATAA
ACACCTAATTTGGATAGCTAACACGAAAATATTGGCCGACCTAATCAGCT
AGGCCTACTAGTTACGAAATGGCGGGCAATTTTTGGCAGAGTTCGCACTC
GCAGCAGTGGATTTTGGACAAACCCGATCTGCTCCGGGAGCGTCAGCACG
ATTTGTTGGCCCTTAACGAGGATGAATACCAAAAGGTGTTTATTTTCTTC
GCAAATGTGATCCAGGTGCTCGGCGAGCAGCTAAAGCTGAGGCAACAGGT
CATCGCCACGGCGACGGTTTACTTCAAGAGATTCTATGCGAGGAACTCCC
TGAAGAACATCGATCCTCTGCTGCTGGCGCCCACTTGCATCTTGCTGGCC
TCGAAGGTGGAGGAGTTCGGTGTCATTTCCAATTCACGACTGATCTCGAT
CTGCCAGTCGGCCATTAAGACAAAGTTCAGCTATGCGTACGCTCAGGAGT
TTCCCTACCGCACCAATCACATCCTGGAGTGCGAGTTTTACCTGCTGGAG
AACCTGGATTGCTGCTTGATTGTCTACCAGCCGTACAGACCGCTGCTGCA
GCTGGTTCAGGACATGGGCCAGGAGGACCAGTTGCTCACCCTGAGCTGGC
GTATCGTAAACGATTCCCTGCGCACCGATGTCTGCCTGCTCTATCCTCCT
TACCAGATCGCTATAGCCTGCCTTCAAATCGCCTGCGTCATCCTGCAAAA
GGACGCCACGAAGCAGTGGTTCGCAGAATTGAATGTTGATTTAGACAAGG
TCCAGGAGATCGTGCGCGCCATTGTAAATCTGTACGAGTTGTGGAAGGAC
TGGAAGGAAAAGGACGAGATTCAGATGCTGCTGTCCAAGATTCCGAAACC
GAAACCACCGCCTCAGCGTTAGAAGAGCTTCATAATCATTCATCATTAGC
TGGTATTGCCCAATTGTGTGTTTGTACTCATATTACCAATGTATTTATGC
CAATTAAACGAAAGTTTAAGCTAGGTGACTAAGCAATCAAAAATGTCATT
TACAAATTATTTTGCCTTTATAATAATTATTTCTAAATTAAATTACATAA
TTGCTTAAGATTAAAAAAAAAAAAAAAAAAA

LD35705.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:16:46
Subject Length Description Subject Range Query Range Score Percent Strand
CycC-RA 1140 CycC-RA 19..1132 1..1114 5570 100 Plus
CG33332.a 1310 CG33332.a 1160..1310 1114..964 755 100 Minus
CG33332-RA 1294 CG33332-RA 1150..1294 1114..970 725 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:20:04
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 10714115..10714820 706..1 3515 99.9 Minus
chr3R 27901430 chr3R 10713649..10714056 1112..705 2025 99.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:30:14 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:20:03
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 14889470..14890175 706..1 3530 100 Minus
3R 32079331 3R 14889002..14889411 1114..705 2050 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:56:59
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 14630301..14631006 706..1 3530 100 Minus
3R 31820162 3R 14629833..14630242 1114..705 2050 100 Minus
Blast to na_te.dros performed on 2019-03-16 04:20:03 has no hits.

LD35705.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:21:05 Download gff for LD35705.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 10713649..10714054 707..1112 92 <- Minus
chr3R 10714115..10714820 1..706 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:17:53 Download gff for LD35705.complete
Subject Subject Range Query Range Percent Splice Strand
CycC-RA 1..804 119..922 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:47:09 Download gff for LD35705.complete
Subject Subject Range Query Range Percent Splice Strand
CycC-RA 1..804 119..922 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:25:19 Download gff for LD35705.complete
Subject Subject Range Query Range Percent Splice Strand
CycC-RA 1..804 119..922 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:38:35 Download gff for LD35705.complete
Subject Subject Range Query Range Percent Splice Strand
CycC-RA 1..804 119..922 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:35:11 Download gff for LD35705.complete
Subject Subject Range Query Range Percent Splice Strand
CycC-RA 1..804 119..922 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:58:59 Download gff for LD35705.complete
Subject Subject Range Query Range Percent Splice Strand
CycC-RA 19..1130 1..1112 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:47:09 Download gff for LD35705.complete
Subject Subject Range Query Range Percent Splice Strand
CycC-RA 19..1130 1..1112 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:25:19 Download gff for LD35705.complete
Subject Subject Range Query Range Percent Splice Strand
CycC-RA 19..1130 1..1112 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:38:36 Download gff for LD35705.complete
Subject Subject Range Query Range Percent Splice Strand
CycC-RA 19..1130 1..1112 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:35:11 Download gff for LD35705.complete
Subject Subject Range Query Range Percent Splice Strand
CycC-RA 31..1142 1..1112 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:21:05 Download gff for LD35705.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14889004..14889409 707..1112 100 <- Minus
3R 14889470..14890175 1..706 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:21:05 Download gff for LD35705.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14889004..14889409 707..1112 100 <- Minus
3R 14889470..14890175 1..706 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:21:05 Download gff for LD35705.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14889004..14889409 707..1112 100 <- Minus
3R 14889470..14890175 1..706 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:25:19 Download gff for LD35705.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 10714726..10715131 707..1112 100 <- Minus
arm_3R 10715192..10715897 1..706 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:08:52 Download gff for LD35705.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14629835..14630240 707..1112 100 <- Minus
3R 14630301..14631006 1..706 100   Minus

LD35705.pep Sequence

Translation from 118 to 921

> LD35705.pep
MAGNFWQSSHSQQWILDKPDLLRERQHDLLALNEDEYQKVFIFFANVIQV
LGEQLKLRQQVIATATVYFKRFYARNSLKNIDPLLLAPTCILLASKVEEF
GVISNSRLISICQSAIKTKFSYAYAQEFPYRTNHILECEFYLLENLDCCL
IVYQPYRPLLQLVQDMGQEDQLLTLSWRIVNDSLRTDVCLLYPPYQIAIA
CLQIACVILQKDATKQWFAELNVDLDKVQEIVRAIVNLYELWKDWKEKDE
IQMLLSKIPKPKPPPQR*

LD35705.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:54:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18125-PA 267 GF18125-PA 1..267 1..267 1382 98.9 Plus
Dana\GF22225-PA 558 GF22225-PA 115..342 31..250 196 28 Plus
Dana\GF15386-PA 402 GF15386-PA 4..255 14..267 189 25.5 Plus
Dana\GF23902-PA 1139 GF23902-PA 94..292 45..240 170 29 Plus
Dana\GF25171-PA 324 GF25171-PA 79..274 61..260 167 25.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:55:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21023-PA 267 GG21023-PA 1..267 1..267 1404 100 Plus
Dere\GG12651-PA 563 GG12651-PA 107..334 31..250 198 28 Plus
Dere\GG21466-PA 401 GG21466-PA 4..240 14..240 185 25.8 Plus
Dere\GG15801-PA 1097 GG15801-PA 75..273 45..240 172 29 Plus
Dere\GG16226-PA 324 GG16226-PA 79..274 61..260 164 26.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:55:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19239-PA 267 GH19239-PA 1..267 1..267 1373 97.4 Plus
Dgri\GH24522-PA 617 GH24522-PA 142..371 29..250 192 28.6 Plus
Dgri\GH10982-PA 434 GH10982-PA 4..255 14..267 190 26.7 Plus
Dgri\GH15353-PA 1111 GH15353-PA 55..253 45..240 171 28.6 Plus
Dgri\GH16374-PA 325 GH16374-PA 80..214 61..202 157 29.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:43:58
Subject Length Description Subject Range Query Range Score Percent Strand
CycC-PA 267 CG7281-PA 1..267 1..267 1398 100 Plus
CG16903-PA 560 CG16903-PA 106..332 32..250 209 27.7 Plus
CycK-PC 400 CG15218-PC 4..255 14..267 185 24.8 Plus
CycK-PB 400 CG15218-PB 4..255 14..267 185 24.8 Plus
CycK-PA 400 CG15218-PA 4..255 14..267 185 24.8 Plus
CycT-PC 1097 CG6292-PC 75..273 45..240 169 29 Plus
CycT-PB 1097 CG6292-PB 75..273 45..240 169 29 Plus
CycH-PA 324 CG7405-PA 79..274 61..260 161 26.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:55:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24273-PA 267 GI24273-PA 1..267 1..267 1305 95.5 Plus
Dmoj\GI21601-PA 587 GI21601-PA 120..336 42..250 194 29.4 Plus
Dmoj\GI17494-PA 415 GI17494-PA 4..255 14..267 191 26.3 Plus
Dmoj\GI12957-PA 1147 GI12957-PA 73..271 45..240 171 28.6 Plus
Dmoj\GI11567-PA 325 GI11567-PA 80..262 61..249 162 27 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:55:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23664-PA 267 GL23664-PA 1..267 1..267 1385 98.1 Plus
Dper\GL18224-PA 540 GL18224-PA 100..327 31..250 196 28.9 Plus
Dper\GL25034-PA 1130 GL25034-PA 71..269 45..240 174 29 Plus
Dper\GL24864-PA 311 GL24864-PA 79..274 61..260 165 27.3 Plus
Dper\GL26256-PA 411 GL26256-PA 4..248 14..267 157 25.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:55:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20234-PA 267 GA20234-PA 1..267 1..267 1385 98.1 Plus
Dpse\GA13578-PA 423 GA13578-PA 4..260 14..267 199 27 Plus
Dpse\GA14208-PA 540 GA14208-PA 100..327 31..250 196 28.9 Plus
Dpse\GA19492-PA 1137 GA19492-PA 78..276 45..240 174 29 Plus
Dpse\GA20328-PA 324 GA20328-PA 79..274 61..260 167 27.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:55:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25819-PA 267 GM25819-PA 1..267 1..267 1404 100 Plus
Dsec\GM18920-PA 559 GM18920-PA 104..331 31..250 198 28 Plus
Dsec\GM16115-PA 400 GM16115-PA 4..259 14..267 184 25.1 Plus
Dsec\GM24323-PA 1093 GM24323-PA 75..273 45..240 173 29 Plus
Dsec\GM22410-PA 324 GM22410-PA 79..213 61..202 164 30.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:55:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20395-PA 267 GD20395-PA 1..267 1..267 1391 99.3 Plus
Dsim\GD16393-PA 559 GD16393-PA 104..331 31..250 198 28 Plus
Dsim\GD21618-PA 400 GD21618-PA 4..259 14..267 184 25.1 Plus
Dsim\GD12396-PA 1097 GD12396-PA 75..273 45..240 172 29 Plus
Dsim\GD15002-PA 324 GD15002-PA 79..213 61..202 166 30.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:55:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10846-PA 267 GJ10846-PA 1..267 1..267 1365 96.6 Plus
Dvir\GJ16541-PA 582 GJ16541-PA 110..337 31..250 193 28.4 Plus
Dvir\GJ15154-PA 425 GJ15154-PA 4..255 14..267 191 26.6 Plus
Dvir\GJ13100-PA 1142 GJ13100-PA 85..283 45..240 170 28.6 Plus
Dvir\GJ11246-PA 325 GJ11246-PA 80..214 61..202 165 30.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:55:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13831-PA 267 GK13831-PA 1..267 1..267 1374 97 Plus
Dwil\GK24907-PA 596 GK24907-PA 132..370 29..254 193 27.2 Plus
Dwil\GK15351-PA 421 GK15351-PA 4..258 14..264 185 26.2 Plus
Dwil\GK17011-PA 1202 GK17011-PA 88..286 45..240 174 29 Plus
Dwil\GK16840-PA 326 GK16840-PA 81..276 61..260 160 25.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:55:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26424-PA 267 GE26424-PA 1..267 1..267 1404 100 Plus
Dyak\GE16978-PA 562 GE16978-PA 107..334 31..250 198 28 Plus
Dyak\GE12968-PA 402 GE12968-PA 4..255 14..267 182 24.7 Plus
Dyak\GE22136-PA 1099 GE22136-PA 77..275 45..240 172 29 Plus
Dyak\GE19794-PA 324 GE19794-PA 79..274 61..260 163 25.7 Plus

LD35705.hyp Sequence

Translation from 118 to 921

> LD35705.hyp
MAGNFWQSSHSQQWILDKPDLLRERQHDLLALNEDEYQKVFIFFANVIQV
LGEQLKLRQQVIATATVYFKRFYARNSLKNIDPLLLAPTCILLASKVEEF
GVISNSRLISICQSAIKTKFSYAYAQEFPYRTNHILECEFYLLENLDCCL
IVYQPYRPLLQLVQDMGQEDQLLTLSWRIVNDSLRTDVCLLYPPYQIAIA
CLQIACVILQKDATKQWFAELNVDLDKVQEIVRAIVNLYELWKDWKEKDE
IQMLLSKIPKPKPPPQR*

LD35705.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:06:14
Subject Length Description Subject Range Query Range Score Percent Strand
CycC-PA 267 CG7281-PA 1..267 1..267 1398 100 Plus
CG16903-PA 560 CG16903-PA 106..332 32..250 209 27.7 Plus
CycK-PC 400 CG15218-PC 4..255 14..267 185 24.8 Plus
CycK-PB 400 CG15218-PB 4..255 14..267 185 24.8 Plus
CycK-PA 400 CG15218-PA 4..255 14..267 185 24.8 Plus