Clone LD35950 Report

Search the DGRC for LD35950

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:359
Well:50
Vector:pOT2
Associated Gene/TranscriptCG11837-RA
Protein status:LD35950.pep: gold
Preliminary Size:1264
Sequenced Size:1104

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11837 2001-01-01 Release 2 assignment
CG11837 2003-01-01 Sim4 clustering to Release 3
CG11837 2003-01-13 Blastp of sequenced clone
CG11837 2008-04-29 Release 5.5 accounting
CG11837 2008-08-15 Release 5.9 accounting
CG11837 2008-12-18 5.12 accounting

Clone Sequence Records

LD35950.complete Sequence

1104 bp (1104 high quality bases) assembled on 2003-01-13

GenBank Submission: AY061429

> LD35950.complete
CCGACTAGGAAGAAGAAGCACATCCAAAACAAATAAATAATTCGTGCAAT
TTATTAATTTTACAAGACAAAAATCCAGTGCTAGACAAGATGCCCAAGGT
TACGAAGGAAAAGAAGAGCCGGATTCATAATGATGTGCAAAAACAGGGGA
TCGTTTTCAACAAGGACTTTGGTCAGCACATCCTGAAGAATCCTCTGGTG
ATAACCACCATGCTGGAGAAAGCCGCTTTGAGAGCTACCGATGTGGTGCT
GGAAATCGGTCCTGGAACCGGAAACATGACCGTTCGGATGCTGGAGCGCG
CCAAGAAAGTGATCGCCTGTGAGATTGACACACGATTGGCCGCCGAGTTG
CAGAAGCGTGTGCAGGCAACTCCGCTGCAGCCGAAGCTCCAGGTGCTGAT
TGGAGACTTCCTAAAGGCGGAGCTGCCCTTCTTCGATCTGTGCATCGCCA
ACGTTCCGTATCAGATCAGTTCGCCACTGATCTTCAAGTTGCTCCTCCAC
CGACCACTCTTCCGTTGCGCCGTACTTATGTTCCAACGCGAGTTCGCAGA
ACGATTGGTGGCCAAACCGGGTGATAAGCTCTACTGTCGTCTGAGTATCA
ACACCCAACTGCTGGCCCGGGTGGACATGCTCATGAAGGTGGGCAAGAAC
AACTTTAGGCCGCCACCAAAGGTAGAAAGCAGTGTGGTCCGGCTGGAGCC
AAAAAACCCACCGCCACCGGTCAACTTCACCGAATGGGACGGACTCACCC
GTATTGCCTTCCTGCGCAAGAACAAAACGCTGGCGGCTACCTTTAAGGTG
ACGTCCGTTTTGGAGATGTTGGAGAAAAACTACAAGCTATACCGCTCACT
CAGGAATGAGCCGATTGAAGACGACTTCAAAATGCAGGATAAGGTCATAA
GTATCTTGGAGGAACAGGACATGGCCGCAAAACGTGCGAGAAGCATGGAC
ATCGACGACTTTATGCGGCTCCTGCTGGCTTTCAATTCAGCGGGCATTCA
CTTCAATTAGTTGTATTTATTCTATAGATCGTTAAACTTTGTACAATTTA
CCAACATTAATATAAATGTTAAGCCAACGAACTTTAAAAAAAAAAAAAAA
AAAA

LD35950.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:27:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG11837-RA 1255 CG11837-RA 31..1117 1..1087 5435 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:51:48
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 24872669..24873382 147..860 3510 99.4 Plus
chr3R 27901430 chr3R 24873445..24873671 859..1085 1120 99.6 Plus
chr3R 27901430 chr3R 24872461..24872608 1..148 710 98.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:30:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:51:46
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29049719..29050432 147..860 3570 100 Plus
3R 32079331 3R 29050495..29050723 859..1087 1145 100 Plus
3R 32079331 3R 29049511..29049658 1..148 740 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:04:26
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 28790550..28791263 147..860 3570 100 Plus
3R 31820162 3R 28791326..28791554 859..1087 1145 100 Plus
3R 31820162 3R 28790342..28790489 1..148 740 100 Plus
Blast to na_te.dros performed on 2019-03-16 11:51:47 has no hits.

LD35950.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:52:26 Download gff for LD35950.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 24872461..24872607 1..147 98 -> Plus
chr3R 24872670..24873382 148..860 99 -> Plus
chr3R 24873447..24873671 861..1085 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:18:14 Download gff for LD35950.complete
Subject Subject Range Query Range Percent Splice Strand
CG11837-RA 1..921 90..1010 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:58:21 Download gff for LD35950.complete
Subject Subject Range Query Range Percent Splice Strand
CG11837-RA 1..921 90..1010 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:42:24 Download gff for LD35950.complete
Subject Subject Range Query Range Percent Splice Strand
CG11837-RA 1..921 90..1010 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:49:09 Download gff for LD35950.complete
Subject Subject Range Query Range Percent Splice Strand
CG11837-RA 1..921 90..1010 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:28:50 Download gff for LD35950.complete
Subject Subject Range Query Range Percent Splice Strand
CG11837-RA 1..921 90..1010 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:14:53 Download gff for LD35950.complete
Subject Subject Range Query Range Percent Splice Strand
CG11837-RA 1..1085 1..1085 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:58:21 Download gff for LD35950.complete
Subject Subject Range Query Range Percent Splice Strand
CG11837-RA 17..1101 1..1085 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:42:24 Download gff for LD35950.complete
Subject Subject Range Query Range Percent Splice Strand
CG11837-RA 19..1103 1..1085 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:49:09 Download gff for LD35950.complete
Subject Subject Range Query Range Percent Splice Strand
CG11837-RA 1..1085 1..1085 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:28:50 Download gff for LD35950.complete
Subject Subject Range Query Range Percent Splice Strand
CG11837-RA 19..1103 1..1085 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:52:26 Download gff for LD35950.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29050497..29050721 861..1085 100   Plus
3R 29049511..29049657 1..147 100 -> Plus
3R 29049720..29050432 148..860 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:52:26 Download gff for LD35950.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29050497..29050721 861..1085 100   Plus
3R 29049511..29049657 1..147 100 -> Plus
3R 29049720..29050432 148..860 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:52:26 Download gff for LD35950.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29050497..29050721 861..1085 100   Plus
3R 29049511..29049657 1..147 100 -> Plus
3R 29049720..29050432 148..860 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:42:24 Download gff for LD35950.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 24876219..24876443 861..1085 100   Plus
arm_3R 24875233..24875379 1..147 100 -> Plus
arm_3R 24875442..24876154 148..860 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:20:35 Download gff for LD35950.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28790551..28791263 148..860 100 -> Plus
3R 28791328..28791552 861..1085 100   Plus
3R 28790342..28790488 1..147 100 -> Plus

LD35950.pep Sequence

Translation from 89 to 1009

> LD35950.pep
MPKVTKEKKSRIHNDVQKQGIVFNKDFGQHILKNPLVITTMLEKAALRAT
DVVLEIGPGTGNMTVRMLERAKKVIACEIDTRLAAELQKRVQATPLQPKL
QVLIGDFLKAELPFFDLCIANVPYQISSPLIFKLLLHRPLFRCAVLMFQR
EFAERLVAKPGDKLYCRLSINTQLLARVDMLMKVGKNNFRPPPKVESSVV
RLEPKNPPPPVNFTEWDGLTRIAFLRKNKTLAATFKVTSVLEMLEKNYKL
YRSLRNEPIEDDFKMQDKVISILEEQDMAAKRARSMDIDDFMRLLLAFNS
AGIHFN*

LD35950.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:18:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16271-PA 306 GF16271-PA 1..306 1..306 1528 93.5 Plus
Dana\GF25284-PA 330 GF25284-PA 34..235 25..208 192 31.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:18:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11635-PA 306 GG11635-PA 1..306 1..306 1595 98.4 Plus
Dere\GG15524-PA 502 GG15524-PA 206..435 25..235 180 29.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:18:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18676-PA 306 GH18676-PA 1..306 1..306 1519 92.5 Plus
Dgri\GH15074-PA 415 GH15074-PA 118..347 25..235 194 30 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:18:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG11837-PA 306 CG11837-PA 1..306 1..306 1557 100 Plus
mtTFB1-PA 330 CG42631-PA 34..257 25..229 181 29.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:18:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24187-PA 306 GI24187-PA 1..306 1..306 1514 92.2 Plus
Dmoj\GI13722-PA 413 GI13722-PA 118..341 25..229 179 29.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:18:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24250-PA 306 GL24250-PA 1..306 1..306 1502 91.5 Plus
Dper\GL16283-PA 337 GL16283-PA 34..257 25..229 196 30.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:18:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11224-PA 306 GA11224-PA 1..306 1..306 1502 91.5 Plus
Dpse\GA20255-PA 337 GA20255-PA 34..257 25..229 193 30.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:18:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12757-PA 306 GM12757-PA 1..306 1..306 1608 99.7 Plus
Dsec\GM25292-PA 414 GM25292-PA 118..341 25..229 180 29.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:18:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21406-PA 306 GD21406-PA 1..306 1..306 1613 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:18:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10534-PA 306 GJ10534-PA 1..306 1..306 1520 92.8 Plus
Dvir\GJ14068-PA 420 GJ14068-PA 130..341 38..229 185 32.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:18:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22567-PA 306 GK22567-PA 1..306 1..306 1501 91.8 Plus
Dwil\GK10486-PA 334 GK10486-PA 34..263 25..235 165 29.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:18:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23825-PA 306 GE23825-PA 1..306 1..306 1584 97.7 Plus

LD35950.hyp Sequence

Translation from 89 to 1009

> LD35950.hyp
MPKVTKEKKSRIHNDVQKQGIVFNKDFGQHILKNPLVITTMLEKAALRAT
DVVLEIGPGTGNMTVRMLERAKKVIACEIDTRLAAELQKRVQATPLQPKL
QVLIGDFLKAELPFFDLCIANVPYQISSPLIFKLLLHRPLFRCAVLMFQR
EFAERLVAKPGDKLYCRLSINTQLLARVDMLMKVGKNNFRPPPKVESSVV
RLEPKNPPPPVNFTEWDGLTRIAFLRKNKTLAATFKVTSVLEMLEKNYKL
YRSLRNEPIEDDFKMQDKVISILEEQDMAAKRARSMDIDDFMRLLLAFNS
AGIHFN*

LD35950.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:44:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG11837-PA 306 CG11837-PA 1..306 1..306 1557 100 Plus
mtTFB1-PA 330 CG42631-PA 34..257 25..229 181 29.5 Plus