BDGP Sequence Production Resources |
Search the DGRC for LD35950
Library: | LD |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Ling Hong |
Date Registered: | 1997-12-04 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 359 |
Well: | 50 |
Vector: | pOT2 |
Associated Gene/Transcript | CG11837-RA |
Protein status: | LD35950.pep: gold |
Preliminary Size: | 1264 |
Sequenced Size: | 1104 |
Gene | Date | Evidence |
---|---|---|
CG11837 | 2001-01-01 | Release 2 assignment |
CG11837 | 2003-01-01 | Sim4 clustering to Release 3 |
CG11837 | 2003-01-13 | Blastp of sequenced clone |
CG11837 | 2008-04-29 | Release 5.5 accounting |
CG11837 | 2008-08-15 | Release 5.9 accounting |
CG11837 | 2008-12-18 | 5.12 accounting |
1104 bp (1104 high quality bases) assembled on 2003-01-13
GenBank Submission: AY061429
> LD35950.complete CCGACTAGGAAGAAGAAGCACATCCAAAACAAATAAATAATTCGTGCAAT TTATTAATTTTACAAGACAAAAATCCAGTGCTAGACAAGATGCCCAAGGT TACGAAGGAAAAGAAGAGCCGGATTCATAATGATGTGCAAAAACAGGGGA TCGTTTTCAACAAGGACTTTGGTCAGCACATCCTGAAGAATCCTCTGGTG ATAACCACCATGCTGGAGAAAGCCGCTTTGAGAGCTACCGATGTGGTGCT GGAAATCGGTCCTGGAACCGGAAACATGACCGTTCGGATGCTGGAGCGCG CCAAGAAAGTGATCGCCTGTGAGATTGACACACGATTGGCCGCCGAGTTG CAGAAGCGTGTGCAGGCAACTCCGCTGCAGCCGAAGCTCCAGGTGCTGAT TGGAGACTTCCTAAAGGCGGAGCTGCCCTTCTTCGATCTGTGCATCGCCA ACGTTCCGTATCAGATCAGTTCGCCACTGATCTTCAAGTTGCTCCTCCAC CGACCACTCTTCCGTTGCGCCGTACTTATGTTCCAACGCGAGTTCGCAGA ACGATTGGTGGCCAAACCGGGTGATAAGCTCTACTGTCGTCTGAGTATCA ACACCCAACTGCTGGCCCGGGTGGACATGCTCATGAAGGTGGGCAAGAAC AACTTTAGGCCGCCACCAAAGGTAGAAAGCAGTGTGGTCCGGCTGGAGCC AAAAAACCCACCGCCACCGGTCAACTTCACCGAATGGGACGGACTCACCC GTATTGCCTTCCTGCGCAAGAACAAAACGCTGGCGGCTACCTTTAAGGTG ACGTCCGTTTTGGAGATGTTGGAGAAAAACTACAAGCTATACCGCTCACT CAGGAATGAGCCGATTGAAGACGACTTCAAAATGCAGGATAAGGTCATAA GTATCTTGGAGGAACAGGACATGGCCGCAAAACGTGCGAGAAGCATGGAC ATCGACGACTTTATGCGGCTCCTGCTGGCTTTCAATTCAGCGGGCATTCA CTTCAATTAGTTGTATTTATTCTATAGATCGTTAAACTTTGTACAATTTA CCAACATTAATATAAATGTTAAGCCAACGAACTTTAAAAAAAAAAAAAAA AAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG11837-RA | 1255 | CG11837-RA | 31..1117 | 1..1087 | 5435 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 24872669..24873382 | 147..860 | 3510 | 99.4 | Plus |
chr3R | 27901430 | chr3R | 24873445..24873671 | 859..1085 | 1120 | 99.6 | Plus |
chr3R | 27901430 | chr3R | 24872461..24872608 | 1..148 | 710 | 98.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 29049719..29050432 | 147..860 | 3570 | 100 | Plus |
3R | 32079331 | 3R | 29050495..29050723 | 859..1087 | 1145 | 100 | Plus |
3R | 32079331 | 3R | 29049511..29049658 | 1..148 | 740 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 28790550..28791263 | 147..860 | 3570 | 100 | Plus |
3R | 31820162 | 3R | 28791326..28791554 | 859..1087 | 1145 | 100 | Plus |
3R | 31820162 | 3R | 28790342..28790489 | 1..148 | 740 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 24872461..24872607 | 1..147 | 98 | -> | Plus |
chr3R | 24872670..24873382 | 148..860 | 99 | -> | Plus |
chr3R | 24873447..24873671 | 861..1085 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11837-RA | 1..921 | 90..1010 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11837-RA | 1..921 | 90..1010 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11837-RA | 1..921 | 90..1010 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11837-RA | 1..921 | 90..1010 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11837-RA | 1..921 | 90..1010 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11837-RA | 1..1085 | 1..1085 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11837-RA | 17..1101 | 1..1085 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11837-RA | 19..1103 | 1..1085 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11837-RA | 1..1085 | 1..1085 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11837-RA | 19..1103 | 1..1085 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 29050497..29050721 | 861..1085 | 100 | Plus | |
3R | 29049511..29049657 | 1..147 | 100 | -> | Plus |
3R | 29049720..29050432 | 148..860 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 29050497..29050721 | 861..1085 | 100 | Plus | |
3R | 29049511..29049657 | 1..147 | 100 | -> | Plus |
3R | 29049720..29050432 | 148..860 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 29050497..29050721 | 861..1085 | 100 | Plus | |
3R | 29049511..29049657 | 1..147 | 100 | -> | Plus |
3R | 29049720..29050432 | 148..860 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 24876219..24876443 | 861..1085 | 100 | Plus | |
arm_3R | 24875233..24875379 | 1..147 | 100 | -> | Plus |
arm_3R | 24875442..24876154 | 148..860 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 28790551..28791263 | 148..860 | 100 | -> | Plus |
3R | 28791328..28791552 | 861..1085 | 100 | Plus | |
3R | 28790342..28790488 | 1..147 | 100 | -> | Plus |
Translation from 89 to 1009
> LD35950.pep MPKVTKEKKSRIHNDVQKQGIVFNKDFGQHILKNPLVITTMLEKAALRAT DVVLEIGPGTGNMTVRMLERAKKVIACEIDTRLAAELQKRVQATPLQPKL QVLIGDFLKAELPFFDLCIANVPYQISSPLIFKLLLHRPLFRCAVLMFQR EFAERLVAKPGDKLYCRLSINTQLLARVDMLMKVGKNNFRPPPKVESSVV RLEPKNPPPPVNFTEWDGLTRIAFLRKNKTLAATFKVTSVLEMLEKNYKL YRSLRNEPIEDDFKMQDKVISILEEQDMAAKRARSMDIDDFMRLLLAFNS AGIHFN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF16271-PA | 306 | GF16271-PA | 1..306 | 1..306 | 1528 | 93.5 | Plus |
Dana\GF25284-PA | 330 | GF25284-PA | 34..235 | 25..208 | 192 | 31.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG11635-PA | 306 | GG11635-PA | 1..306 | 1..306 | 1595 | 98.4 | Plus |
Dere\GG15524-PA | 502 | GG15524-PA | 206..435 | 25..235 | 180 | 29.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18676-PA | 306 | GH18676-PA | 1..306 | 1..306 | 1519 | 92.5 | Plus |
Dgri\GH15074-PA | 415 | GH15074-PA | 118..347 | 25..235 | 194 | 30 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG11837-PA | 306 | CG11837-PA | 1..306 | 1..306 | 1557 | 100 | Plus |
mtTFB1-PA | 330 | CG42631-PA | 34..257 | 25..229 | 181 | 29.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI24187-PA | 306 | GI24187-PA | 1..306 | 1..306 | 1514 | 92.2 | Plus |
Dmoj\GI13722-PA | 413 | GI13722-PA | 118..341 | 25..229 | 179 | 29.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24250-PA | 306 | GL24250-PA | 1..306 | 1..306 | 1502 | 91.5 | Plus |
Dper\GL16283-PA | 337 | GL16283-PA | 34..257 | 25..229 | 196 | 30.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA11224-PA | 306 | GA11224-PA | 1..306 | 1..306 | 1502 | 91.5 | Plus |
Dpse\GA20255-PA | 337 | GA20255-PA | 34..257 | 25..229 | 193 | 30.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM12757-PA | 306 | GM12757-PA | 1..306 | 1..306 | 1608 | 99.7 | Plus |
Dsec\GM25292-PA | 414 | GM25292-PA | 118..341 | 25..229 | 180 | 29.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD21406-PA | 306 | GD21406-PA | 1..306 | 1..306 | 1613 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ10534-PA | 306 | GJ10534-PA | 1..306 | 1..306 | 1520 | 92.8 | Plus |
Dvir\GJ14068-PA | 420 | GJ14068-PA | 130..341 | 38..229 | 185 | 32.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK22567-PA | 306 | GK22567-PA | 1..306 | 1..306 | 1501 | 91.8 | Plus |
Dwil\GK10486-PA | 334 | GK10486-PA | 34..263 | 25..235 | 165 | 29.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE23825-PA | 306 | GE23825-PA | 1..306 | 1..306 | 1584 | 97.7 | Plus |
Translation from 89 to 1009
> LD35950.hyp MPKVTKEKKSRIHNDVQKQGIVFNKDFGQHILKNPLVITTMLEKAALRAT DVVLEIGPGTGNMTVRMLERAKKVIACEIDTRLAAELQKRVQATPLQPKL QVLIGDFLKAELPFFDLCIANVPYQISSPLIFKLLLHRPLFRCAVLMFQR EFAERLVAKPGDKLYCRLSINTQLLARVDMLMKVGKNNFRPPPKVESSVV RLEPKNPPPPVNFTEWDGLTRIAFLRKNKTLAATFKVTSVLEMLEKNYKL YRSLRNEPIEDDFKMQDKVISILEEQDMAAKRARSMDIDDFMRLLLAFNS AGIHFN*