Clone LD36125 Report

Search the DGRC for LD36125

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:361
Well:25
Vector:pOT2
Associated Gene/Transcriptborr-RA
Protein status:LD36125.pep: gold
Preliminary Size:1387
Sequenced Size:1249

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4454 2001-01-01 Release 2 assignment
CG4454 2003-01-01 Sim4 clustering to Release 3
CG4454 2003-02-27 Blastp of sequenced clone
Borr 2008-04-29 Release 5.5 accounting
Borr 2008-08-15 Release 5.9 accounting
borr 2008-12-18 5.12 accounting

Clone Sequence Records

LD36125.complete Sequence

1249 bp (1249 high quality bases) assembled on 2003-02-27

GenBank Submission: AY061432

> LD36125.complete
AAAAAGACGACGCTTGCTACGAAAATAGTTATTCCTCGCAAAAACCCTGT
AACGTGTAAACAAAGGCCGCTGCCACGATGCCGCGCACCAAGATACCAAA
GAACTCCAAACGCAACCGCGAGGTGGCCAATCGCGAAGAGAAGGTGCGCC
TGTACGAGCTGAAAATGGATTCCCGCCTTATCAGCATCGATTCGCTGGAG
ACCAAGTTCCTCTCCGCCGTGGACCACCAGGTGAAGACACTGCTCGGCCA
GGTGCAGAAGGAGCTGGCCAATCTGAAGATGCCCGAAGTGCTGCGCCTCT
TCGAGGAACTGGACCGCTTCAGCGACTTCAAGGCCAGCGATCAGACGCAG
CTGCTCGCCTCGATGTCCATGAGTGGCAGCGCCATCGAGGGCCACGCCCC
CTCCGCCACTGGAAGTCGCAATGACGAAGAGGACAGCAGCATCGGTGCCA
GCGGTGGGAGCATCCTGGCCGCCCACACAGGCTCCCTGCTGCGGTCCACG
AAGGCCATGCGCACACCCGGACCACTGCACTCGGCGAGGGCTCGTCGAGC
GCGGCGCAGTCGTTCCGCCTGCGGGGATCTCAACATATTGCACTCGGCCA
AACCGCCGTCAATTTCGAGCAGCAGCAGCAGCAGCCGCAATTCGCGCAGC
AAACTGCGCACACCGATGGCCTCGCGTGCGAAGGCCTTCAGTGCCGACCG
CACTCCTTTGAAACAGAAGCAAATGCGCTCCGGATCGCCAACTACACCGC
CGATGGCATTCCTGCGCTATCCCAAGCCCGGCGAGGTGGCACTATCCAAA
TACGGCAGTCCCATGGTGGCTCAAGTAATGCCAGACAAGTTCGCCAATGT
GAACATACCCATTCGGAACGGAGTTCTTAGCTTGCGGCCCAAAAAACTGG
ATGCCGACGAGGTGGAGTCAAATCTGTTGGAGAACCTGGACGAGGACACC
CTTAACCAGATCAAAACGCTGCACGAGAACTTGCAGATGATTGTTAATAA
GGCCAGCCAGGCGGTGTTCAAGTAGCTGTCATTTCAAACGCTTATCTAGA
TATAATGCTATATCATATATTTTAATACGTTTCGTTTAAGTTCAGTTTTC
ATTTTACTCATTTAGTTCAAGTATTTTGTCTTTATTCATAAAAATCTATC
GTATTTGCATAAGTTTCAATACATGTTCATATCCAAGTGTACGGCGATTT
AAATGTAATGTTTTAAATACATGCTTAATCCAAAAAAAAAAAAAAAAAA

LD36125.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:16:47
Subject Length Description Subject Range Query Range Score Percent Strand
borr.a 1642 borr.a 54..1297 1..1244 6220 100 Plus
borr-RB 1411 borr-RB 497..1313 428..1244 4085 100 Plus
borr.b 1654 borr.b 493..1309 428..1244 4085 100 Plus
borr-RB 1411 borr-RB 58..486 1..429 2145 100 Plus
borr.b 1654 borr.b 54..482 1..429 2145 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:38:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 9251566..9251994 429..1 2145 100 Minus
chr2L 23010047 chr2L 9250403..9250807 1231..827 2025 100 Minus
chr2L 23010047 chr2L 9250873..9251271 826..428 1995 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:30:50 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:38:34
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9252635..9253063 429..1 2145 100 Minus
2L 23513712 2L 9251459..9251876 1244..827 2090 100 Minus
2L 23513712 2L 9251942..9252340 826..428 1995 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:57:00
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9252635..9253063 429..1 2145 100 Minus
2L 23513712 2L 9251459..9251876 1244..827 2090 100 Minus
2L 23513712 2L 9251942..9252340 826..428 1995 100 Minus
Blast to na_te.dros performed on 2019-03-16 16:38:34 has no hits.

LD36125.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:39:40 Download gff for LD36125.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 9250403..9250807 827..1231 100 <- Minus
chr2L 9250873..9251269 430..826 100 <- Minus
chr2L 9251566..9251994 1..429 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:18:31 Download gff for LD36125.complete
Subject Subject Range Query Range Percent Splice Strand
borr-RA 1..948 78..1025 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:47:10 Download gff for LD36125.complete
Subject Subject Range Query Range Percent Splice Strand
borr-RA 1..948 78..1025 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:21:12 Download gff for LD36125.complete
Subject Subject Range Query Range Percent Splice Strand
borr-RA 1..948 78..1025 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:38:37 Download gff for LD36125.complete
Subject Subject Range Query Range Percent Splice Strand
Borr-RA 1..948 78..1025 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:36:59 Download gff for LD36125.complete
Subject Subject Range Query Range Percent Splice Strand
borr-RA 1..948 78..1025 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:59:01 Download gff for LD36125.complete
Subject Subject Range Query Range Percent Splice Strand
borr-RA 54..1284 1..1231 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:47:10 Download gff for LD36125.complete
Subject Subject Range Query Range Percent Splice Strand
borr-RA 51..1281 1..1231 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:21:12 Download gff for LD36125.complete
Subject Subject Range Query Range Percent Splice Strand
borr-RA 56..1286 1..1231 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:38:37 Download gff for LD36125.complete
Subject Subject Range Query Range Percent Splice Strand
Borr-RA 54..1284 1..1231 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:36:59 Download gff for LD36125.complete
Subject Subject Range Query Range Percent Splice Strand
borr-RA 56..1286 1..1231 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:39:40 Download gff for LD36125.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9251472..9251876 827..1231 100 <- Minus
2L 9251942..9252338 430..826 100 <- Minus
2L 9252635..9253063 1..429 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:39:40 Download gff for LD36125.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9251472..9251876 827..1231 100 <- Minus
2L 9251942..9252338 430..826 100 <- Minus
2L 9252635..9253063 1..429 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:39:40 Download gff for LD36125.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9251472..9251876 827..1231 100 <- Minus
2L 9251942..9252338 430..826 100 <- Minus
2L 9252635..9253063 1..429 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:21:12 Download gff for LD36125.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9251472..9251876 827..1231 100 <- Minus
arm_2L 9251942..9252338 430..826 100 <- Minus
arm_2L 9252635..9253063 1..429 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:08:53 Download gff for LD36125.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9251472..9251876 827..1231 100 <- Minus
2L 9251942..9252338 430..826 100 <- Minus
2L 9252635..9253063 1..429 100   Minus

LD36125.pep Sequence

Translation from 77 to 1024

> LD36125.pep
MPRTKIPKNSKRNREVANREEKVRLYELKMDSRLISIDSLETKFLSAVDH
QVKTLLGQVQKELANLKMPEVLRLFEELDRFSDFKASDQTQLLASMSMSG
SAIEGHAPSATGSRNDEEDSSIGASGGSILAAHTGSLLRSTKAMRTPGPL
HSARARRARRSRSACGDLNILHSAKPPSISSSSSSSRNSRSKLRTPMASR
AKAFSADRTPLKQKQMRSGSPTTPPMAFLRYPKPGEVALSKYGSPMVAQV
MPDKFANVNIPIRNGVLSLRPKKLDADEVESNLLENLDEDTLNQIKTLHE
NLQMIVNKASQAVFK*

LD36125.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:56:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22038-PA 318 GF22038-PA 1..318 1..315 1151 74.1 Plus
Dana\GF22049-PA 218 GF22049-PA 87..214 179..311 232 38.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:56:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24035-PA 312 GG24035-PA 1..312 1..315 1553 95.6 Plus
Dere\GG24036-PA 218 GG24036-PA 88..212 175..311 259 40.7 Plus
Dere\GG24036-PA 218 GG24036-PA 1..85 1..87 164 42.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:56:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13640-PA 316 GH13640-PA 1..316 1..315 905 61.8 Plus
Dgri\GH13271-PA 183 GH13271-PA 1..183 138..315 582 70.8 Plus
Dgri\GH13272-PA 225 GH13272-PA 87..221 173..311 267 45.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:30:51
Subject Length Description Subject Range Query Range Score Percent Strand
borr-PA 315 CG4454-PA 1..315 1..315 1564 100 Plus
borr-PB 319 CG4454-PB 1..319 1..315 1549 98.7 Plus
aust-PB 216 CG17009-PB 88..210 175..311 236 41.4 Plus
aust-PA 216 CG17009-PA 88..210 175..311 236 41.4 Plus
aust-PB 216 CG17009-PB 1..98 1..99 178 41 Plus
aust-PA 216 CG17009-PA 1..98 1..99 178 41 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:56:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11901-PA 324 GI11901-PA 1..324 1..315 949 63.7 Plus
Dmoj\GI11912-PA 221 GI11912-PA 87..217 174..311 278 46.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:56:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25535-PA 318 GL25535-PA 1..318 1..315 1164 74.5 Plus
Dper\GL21274-PA 226 GL21274-PA 87..222 175..311 215 38.7 Plus
Dper\GL10058-PA 226 GL10058-PA 87..222 175..311 202 38 Plus
Dper\GL19675-PA 226 GL19675-PA 87..222 175..311 199 37.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:56:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18196-PA 318 GA18196-PA 1..318 1..315 1169 75.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:56:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12517-PA 314 GM12517-PA 1..314 1..315 1614 98.7 Plus
Dsec\GM12528-PA 217 GM12528-PA 86..211 173..311 244 38.8 Plus
Dsec\GM12528-PA 217 GM12528-PA 1..74 1..74 168 45.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:56:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22362-PA 315 GD22362-PA 1..315 1..315 1626 98.7 Plus
Dsim\GD22363-PA 216 GD22363-PA 86..210 173..311 238 38.7 Plus
Dsim\GD22363-PA 216 GD22363-PA 1..74 1..74 168 45.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:56:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14013-PA 325 GJ14013-PA 1..325 1..315 951 65.2 Plus
Dvir\GJ14024-PA 220 GJ14024-PA 89..216 175..311 263 46.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:56:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15062-PA 331 GK15062-PA 1..331 1..315 852 58.2 Plus
Dwil\GK15971-PA 257 GK15971-PA 1..257 30..315 489 43.9 Plus
Dwil\GK15063-PA 144 GK15063-PA 59..142 225..310 174 40.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:56:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10577-PA 313 GE10577-PA 1..313 1..315 1601 97.8 Plus
Dyak\GE10588-PA 218 GE10588-PA 88..212 175..311 257 42.1 Plus
Dyak\GE10588-PA 218 GE10588-PA 1..74 1..74 165 47.3 Plus

LD36125.hyp Sequence

Translation from 77 to 1024

> LD36125.hyp
MPRTKIPKNSKRNREVANREEKVRLYELKMDSRLISIDSLETKFLSAVDH
QVKTLLGQVQKELANLKMPEVLRLFEELDRFSDFKASDQTQLLASMSMSG
SAIEGHAPSATGSRNDEEDSSIGASGGSILAAHTGSLLRSTKAMRTPGPL
HSARARRARRSRSACGDLNILHSAKPPSISSSSSSSRNSRSKLRTPMASR
AKAFSADRTPLKQKQMRSGSPTTPPMAFLRYPKPGEVALSKYGSPMVAQV
MPDKFANVNIPIRNGVLSLRPKKLDADEVESNLLENLDEDTLNQIKTLHE
NLQMIVNKASQAVFK*

LD36125.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:04:05
Subject Length Description Subject Range Query Range Score Percent Strand
borr-PA 315 CG4454-PA 1..315 1..315 1564 100 Plus
borr-PB 319 CG4454-PB 1..319 1..315 1549 98.7 Plus
aust-PB 216 CG17009-PB 88..210 175..311 236 41.4 Plus
aust-PA 216 CG17009-PA 88..210 175..311 236 41.4 Plus
aust-PB 216 CG17009-PB 1..98 1..99 178 41 Plus
aust-PA 216 CG17009-PA 1..98 1..99 178 41 Plus