Clone LD36173 Report

Search the DGRC for LD36173

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:361
Well:73
Vector:pOT2
Associated Gene/TranscriptCHMP2B-RA
Protein status:LD36173.pep: gold
Preliminary Size:987
Sequenced Size:818

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4618 2001-01-01 Release 2 assignment
CG4618 2003-01-01 Sim4 clustering to Release 3
CG4618 2003-02-27 Blastp of sequenced clone
CG4618 2008-04-29 Release 5.5 accounting
CG4618 2008-08-15 Release 5.9 accounting
CG4618 2008-12-18 5.12 accounting

Clone Sequence Records

LD36173.complete Sequence

818 bp (818 high quality bases) assembled on 2003-02-27

GenBank Submission: AY061433

> LD36173.complete
ATCATCAGGAAAACCCATCACAACATCGTCAGAAGTCGGAAACCTTAGTT
TAAGATCGCACCAAATCCCAAAATGTTCAACAATATTTTCGGAAAGAAAC
CCACCGTGAAGGAGCAGCAGCGGGAGAATGACCGATCGCTGCGCAAGGCC
ACCAGGGACATCGAACGGGAGCGCAGGAAAATGGAGGAGGAGGAGCGCAA
GCTGGAGCTGGAGATCCGACGGAATGCCGCCGCTGGGAACAACGATGCCT
GCCGCATTCTGGCCAAGCAGCTGGTGGAGATCAGGAAGCAGAAATCACGC
ACATACGCAGCAGCGGGCAAGATTCAGTCCATTGGCTACCAGAACAAGAA
CATGGGCGCCAATATCGCCCTAAGCGAAGCCATGGGCACCACGGCCAAGA
CGATGGGTGAAATGAATAAGGTGATGCGACCGGAGGCCATCGGGGAAACA
GTGCGCCAGTTCCAGGCGGCCAACATGAAGATGGAAATGACCGACGAGAT
GATCAACGACACGCTGGACGACATGCTGAATGAGTCCGGCGACGAGGAGG
AGTCCAATGCCGTAGTCAACAAGGTGCTCGACGAGATCGGCATCGAGATC
TCCGGCAAGATGTCCAGCATCCCGGCCACGGGATCCTCAGACTTTGAGAC
GAGTGGCAAGCGCACCGAGAAGGACATTGCCGATCAACTGGCCAAGCTGC
GCTCCTCTTAGTCCTTACCTGTTTTTCATTCTATTTTGTAACTACTGTGA
ACATCGCTGTTATCCATAGCCCGTAAGAAATTATATTTATGTACACCGCT
TAAAAAAAAAAAAAAAAA

LD36173.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:52:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG4618-RA 801 CG4618-RA 1..801 1..801 4005 100 Plus
CG10672-RA 1288 CG10672-RA 1155..1288 806..673 655 99.2 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:57:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 5132229..5133027 1..798 3825 98.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:30:56 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:57:50
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 5139673..5140478 1..806 4015 99.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:11:45
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 5132773..5133578 1..806 4015 99.8 Plus
Blast to na_te.dros performed on 2019-03-16 10:57:50 has no hits.

LD36173.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:58:58 Download gff for LD36173.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 5132229..5133030 1..801 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:18:38 Download gff for LD36173.complete
Subject Subject Range Query Range Percent Splice Strand
CG4618-RA 1..639 73..711 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:48:38 Download gff for LD36173.complete
Subject Subject Range Query Range Percent Splice Strand
CHMP2B-RA 1..639 73..711 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:37:57 Download gff for LD36173.complete
Subject Subject Range Query Range Percent Splice Strand
CHMP2B-RA 1..639 73..711 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:30:33 Download gff for LD36173.complete
Subject Subject Range Query Range Percent Splice Strand
CG4618-RA 1..639 73..711 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:21:46 Download gff for LD36173.complete
Subject Subject Range Query Range Percent Splice Strand
CHMP2B-RA 1..639 73..711 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:58:35 Download gff for LD36173.complete
Subject Subject Range Query Range Percent Splice Strand
CG4618-RA 10..810 1..801 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:48:38 Download gff for LD36173.complete
Subject Subject Range Query Range Percent Splice Strand
CHMP2B-RA 1..801 1..801 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:37:57 Download gff for LD36173.complete
Subject Subject Range Query Range Percent Splice Strand
CHMP2B-RA 55..855 1..801 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:30:33 Download gff for LD36173.complete
Subject Subject Range Query Range Percent Splice Strand
CG4618-RA 10..810 1..801 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:21:46 Download gff for LD36173.complete
Subject Subject Range Query Range Percent Splice Strand
CHMP2B-RA 55..855 1..801 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:58:58 Download gff for LD36173.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5139673..5140473 1..801 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:58:58 Download gff for LD36173.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5139673..5140473 1..801 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:58:58 Download gff for LD36173.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5139673..5140473 1..801 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:37:57 Download gff for LD36173.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 5132773..5133573 1..801 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:08:17 Download gff for LD36173.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5132773..5133573 1..801 100   Plus

LD36173.hyp Sequence

Translation from 72 to 710

> LD36173.hyp
MFNNIFGKKPTVKEQQRENDRSLRKATRDIERERRKMEEEERKLELEIRR
NAAAGNNDACRILAKQLVEIRKQKSRTYAAAGKIQSIGYQNKNMGANIAL
SEAMGTTAKTMGEMNKVMRPEAIGETVRQFQAANMKMEMTDEMINDTLDD
MLNESGDEEESNAVVNKVLDEIGIEISGKMSSIPATGSSDFETSGKRTEK
DIADQLAKLRSS*

LD36173.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:14:34
Subject Length Description Subject Range Query Range Score Percent Strand
CHMP2B-PA 212 CG4618-PA 1..212 1..212 1051 100 Plus
Vps2-PA 256 CG14542-PA 4..199 5..200 349 34.7 Plus
Vps24-PA 223 CG9779-PA 3..206 5..205 227 28 Plus
Chmp1-PB 203 CG4108-PB 12..202 22..212 160 19.9 Plus
Chmp1-PA 203 CG4108-PA 12..202 22..212 160 19.9 Plus

LD36173.pep Sequence

Translation from 72 to 710

> LD36173.pep
MFNNIFGKKPTVKEQQRENDRSLRKATRDIERERRKMEEEERKLELEIRR
NAAAGNNDACRILAKQLVEIRKQKSRTYAAAGKIQSIGYQNKNMGANIAL
SEAMGTTAKTMGEMNKVMRPEAIGETVRQFQAANMKMEMTDEMINDTLDD
MLNESGDEEESNAVVNKVLDEIGIEISGKMSSIPATGSSDFETSGKRTEK
DIADQLAKLRSS*

LD36173.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:47:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23969-PA 212 GF23969-PA 1..212 1..212 949 92.9 Plus
Dana\GF16804-PA 252 GF16804-PA 1..188 2..188 270 35.6 Plus
Dana\GF16818-PA 226 GF16818-PA 3..181 5..184 185 30.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:47:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15261-PA 212 GG15261-PA 1..212 1..212 1092 99.5 Plus
Dere\GG11461-PA 256 GG11461-PA 1..188 2..188 272 36.2 Plus
Dere\GG11685-PA 223 GG11685-PA 3..181 5..184 185 29.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:47:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16177-PA 212 GH16177-PA 1..212 1..212 917 90.6 Plus
Dgri\GH19462-PA 259 GH19462-PA 1..188 2..188 270 35.6 Plus
Dgri\GH17415-PA 225 GH17415-PA 3..203 5..202 173 27.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:24
Subject Length Description Subject Range Query Range Score Percent Strand
CHMP2B-PA 212 CG4618-PA 1..212 1..212 1051 100 Plus
Vps2-PA 256 CG14542-PA 4..199 5..200 349 34.7 Plus
Vps24-PB 223 CG9779-PB 3..206 5..205 227 28 Plus
Vps24-PA 223 CG9779-PA 3..206 5..205 227 28 Plus
Chmp1-PB 203 CG4108-PB 12..202 22..212 160 19.9 Plus
Chmp1-PA 203 CG4108-PA 12..202 22..212 160 19.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:47:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13330-PA 212 GI13330-PA 1..212 1..212 925 91 Plus
Dmoj\GI24696-PA 253 GI24696-PA 1..193 2..195 269 34.5 Plus
Dmoj\GI22744-PA 223 GI22744-PA 3..181 5..184 186 30.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:47:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22617-PA 212 GL22617-PA 1..212 1..212 939 92 Plus
Dper\GL21825-PA 256 GL21825-PA 1..188 2..188 271 36.2 Plus
Dper\GL12331-PA 223 GL12331-PA 3..181 5..184 180 29.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:47:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18306-PA 212 GA18306-PA 1..212 1..212 939 92 Plus
Dpse\GA13067-PA 256 GA13067-PA 1..188 2..188 271 36.2 Plus
Dpse\GA22030-PA 223 GA22030-PA 3..181 5..184 181 29.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:47:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14695-PA 212 GM14695-PA 1..212 1..212 1097 100 Plus
Dsec\GM10303-PA 256 GM10303-PA 1..188 2..188 272 36.2 Plus
Dsec\GM10712-PA 223 GM10712-PA 3..181 5..184 186 29.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:47:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13878-PA 232 GD13878-PA 1..186 1..190 507 66.8 Plus
Dsim\GD21266-PA 256 GD21266-PA 1..188 2..188 272 36.2 Plus
Dsim\GD19689-PA 223 GD19689-PA 3..181 5..184 186 29.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:47:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13157-PA 212 GJ13157-PA 1..212 1..212 1000 90.6 Plus
Dvir\GJ23912-PA 251 GJ23912-PA 1..188 2..188 270 35.6 Plus
Dvir\GJ22745-PA 223 GJ22745-PA 3..181 5..184 183 29.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:47:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20320-PA 213 GK20320-PA 1..213 1..212 1003 91.5 Plus
Dwil\GK14462-PA 251 GK14462-PA 1..188 2..188 271 36.2 Plus
Dwil\GK12139-PA 229 GK12139-PA 3..193 5..189 188 28.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:47:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21483-PA 212 GE21483-PA 1..212 1..212 1075 97.6 Plus
Dyak\GE23653-PA 256 GE23653-PA 1..188 2..188 272 36.2 Plus
Dyak\GE25363-PA 223 GE25363-PA 3..181 5..184 176 29.1 Plus