BDGP Sequence Production Resources |
Search the DGRC for LD36173
Library: | LD |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Ling Hong |
Date Registered: | 1997-12-04 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 361 |
Well: | 73 |
Vector: | pOT2 |
Associated Gene/Transcript | CHMP2B-RA |
Protein status: | LD36173.pep: gold |
Preliminary Size: | 987 |
Sequenced Size: | 818 |
Gene | Date | Evidence |
---|---|---|
CG4618 | 2001-01-01 | Release 2 assignment |
CG4618 | 2003-01-01 | Sim4 clustering to Release 3 |
CG4618 | 2003-02-27 | Blastp of sequenced clone |
CG4618 | 2008-04-29 | Release 5.5 accounting |
CG4618 | 2008-08-15 | Release 5.9 accounting |
CG4618 | 2008-12-18 | 5.12 accounting |
818 bp (818 high quality bases) assembled on 2003-02-27
GenBank Submission: AY061433
> LD36173.complete ATCATCAGGAAAACCCATCACAACATCGTCAGAAGTCGGAAACCTTAGTT TAAGATCGCACCAAATCCCAAAATGTTCAACAATATTTTCGGAAAGAAAC CCACCGTGAAGGAGCAGCAGCGGGAGAATGACCGATCGCTGCGCAAGGCC ACCAGGGACATCGAACGGGAGCGCAGGAAAATGGAGGAGGAGGAGCGCAA GCTGGAGCTGGAGATCCGACGGAATGCCGCCGCTGGGAACAACGATGCCT GCCGCATTCTGGCCAAGCAGCTGGTGGAGATCAGGAAGCAGAAATCACGC ACATACGCAGCAGCGGGCAAGATTCAGTCCATTGGCTACCAGAACAAGAA CATGGGCGCCAATATCGCCCTAAGCGAAGCCATGGGCACCACGGCCAAGA CGATGGGTGAAATGAATAAGGTGATGCGACCGGAGGCCATCGGGGAAACA GTGCGCCAGTTCCAGGCGGCCAACATGAAGATGGAAATGACCGACGAGAT GATCAACGACACGCTGGACGACATGCTGAATGAGTCCGGCGACGAGGAGG AGTCCAATGCCGTAGTCAACAAGGTGCTCGACGAGATCGGCATCGAGATC TCCGGCAAGATGTCCAGCATCCCGGCCACGGGATCCTCAGACTTTGAGAC GAGTGGCAAGCGCACCGAGAAGGACATTGCCGATCAACTGGCCAAGCTGC GCTCCTCTTAGTCCTTACCTGTTTTTCATTCTATTTTGTAACTACTGTGA ACATCGCTGTTATCCATAGCCCGTAAGAAATTATATTTATGTACACCGCT TAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 5132229..5133027 | 1..798 | 3825 | 98.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 5139673..5140478 | 1..806 | 4015 | 99.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 5132773..5133578 | 1..806 | 4015 | 99.8 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 5132229..5133030 | 1..801 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4618-RA | 1..639 | 73..711 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CHMP2B-RA | 1..639 | 73..711 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CHMP2B-RA | 1..639 | 73..711 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4618-RA | 1..639 | 73..711 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CHMP2B-RA | 1..639 | 73..711 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4618-RA | 10..810 | 1..801 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CHMP2B-RA | 1..801 | 1..801 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CHMP2B-RA | 55..855 | 1..801 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4618-RA | 10..810 | 1..801 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CHMP2B-RA | 55..855 | 1..801 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 5139673..5140473 | 1..801 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 5139673..5140473 | 1..801 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 5139673..5140473 | 1..801 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 5132773..5133573 | 1..801 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 5132773..5133573 | 1..801 | 100 | Plus |
Translation from 72 to 710
> LD36173.hyp MFNNIFGKKPTVKEQQRENDRSLRKATRDIERERRKMEEEERKLELEIRR NAAAGNNDACRILAKQLVEIRKQKSRTYAAAGKIQSIGYQNKNMGANIAL SEAMGTTAKTMGEMNKVMRPEAIGETVRQFQAANMKMEMTDEMINDTLDD MLNESGDEEESNAVVNKVLDEIGIEISGKMSSIPATGSSDFETSGKRTEK DIADQLAKLRSS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CHMP2B-PA | 212 | CG4618-PA | 1..212 | 1..212 | 1051 | 100 | Plus |
Vps2-PA | 256 | CG14542-PA | 4..199 | 5..200 | 349 | 34.7 | Plus |
Vps24-PA | 223 | CG9779-PA | 3..206 | 5..205 | 227 | 28 | Plus |
Chmp1-PB | 203 | CG4108-PB | 12..202 | 22..212 | 160 | 19.9 | Plus |
Chmp1-PA | 203 | CG4108-PA | 12..202 | 22..212 | 160 | 19.9 | Plus |
Translation from 72 to 710
> LD36173.pep MFNNIFGKKPTVKEQQRENDRSLRKATRDIERERRKMEEEERKLELEIRR NAAAGNNDACRILAKQLVEIRKQKSRTYAAAGKIQSIGYQNKNMGANIAL SEAMGTTAKTMGEMNKVMRPEAIGETVRQFQAANMKMEMTDEMINDTLDD MLNESGDEEESNAVVNKVLDEIGIEISGKMSSIPATGSSDFETSGKRTEK DIADQLAKLRSS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23969-PA | 212 | GF23969-PA | 1..212 | 1..212 | 949 | 92.9 | Plus |
Dana\GF16804-PA | 252 | GF16804-PA | 1..188 | 2..188 | 270 | 35.6 | Plus |
Dana\GF16818-PA | 226 | GF16818-PA | 3..181 | 5..184 | 185 | 30.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15261-PA | 212 | GG15261-PA | 1..212 | 1..212 | 1092 | 99.5 | Plus |
Dere\GG11461-PA | 256 | GG11461-PA | 1..188 | 2..188 | 272 | 36.2 | Plus |
Dere\GG11685-PA | 223 | GG11685-PA | 3..181 | 5..184 | 185 | 29.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH16177-PA | 212 | GH16177-PA | 1..212 | 1..212 | 917 | 90.6 | Plus |
Dgri\GH19462-PA | 259 | GH19462-PA | 1..188 | 2..188 | 270 | 35.6 | Plus |
Dgri\GH17415-PA | 225 | GH17415-PA | 3..203 | 5..202 | 173 | 27.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CHMP2B-PA | 212 | CG4618-PA | 1..212 | 1..212 | 1051 | 100 | Plus |
Vps2-PA | 256 | CG14542-PA | 4..199 | 5..200 | 349 | 34.7 | Plus |
Vps24-PB | 223 | CG9779-PB | 3..206 | 5..205 | 227 | 28 | Plus |
Vps24-PA | 223 | CG9779-PA | 3..206 | 5..205 | 227 | 28 | Plus |
Chmp1-PB | 203 | CG4108-PB | 12..202 | 22..212 | 160 | 19.9 | Plus |
Chmp1-PA | 203 | CG4108-PA | 12..202 | 22..212 | 160 | 19.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI13330-PA | 212 | GI13330-PA | 1..212 | 1..212 | 925 | 91 | Plus |
Dmoj\GI24696-PA | 253 | GI24696-PA | 1..193 | 2..195 | 269 | 34.5 | Plus |
Dmoj\GI22744-PA | 223 | GI22744-PA | 3..181 | 5..184 | 186 | 30.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL22617-PA | 212 | GL22617-PA | 1..212 | 1..212 | 939 | 92 | Plus |
Dper\GL21825-PA | 256 | GL21825-PA | 1..188 | 2..188 | 271 | 36.2 | Plus |
Dper\GL12331-PA | 223 | GL12331-PA | 3..181 | 5..184 | 180 | 29.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA18306-PA | 212 | GA18306-PA | 1..212 | 1..212 | 939 | 92 | Plus |
Dpse\GA13067-PA | 256 | GA13067-PA | 1..188 | 2..188 | 271 | 36.2 | Plus |
Dpse\GA22030-PA | 223 | GA22030-PA | 3..181 | 5..184 | 181 | 29.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM14695-PA | 212 | GM14695-PA | 1..212 | 1..212 | 1097 | 100 | Plus |
Dsec\GM10303-PA | 256 | GM10303-PA | 1..188 | 2..188 | 272 | 36.2 | Plus |
Dsec\GM10712-PA | 223 | GM10712-PA | 3..181 | 5..184 | 186 | 29.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD13878-PA | 232 | GD13878-PA | 1..186 | 1..190 | 507 | 66.8 | Plus |
Dsim\GD21266-PA | 256 | GD21266-PA | 1..188 | 2..188 | 272 | 36.2 | Plus |
Dsim\GD19689-PA | 223 | GD19689-PA | 3..181 | 5..184 | 186 | 29.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13157-PA | 212 | GJ13157-PA | 1..212 | 1..212 | 1000 | 90.6 | Plus |
Dvir\GJ23912-PA | 251 | GJ23912-PA | 1..188 | 2..188 | 270 | 35.6 | Plus |
Dvir\GJ22745-PA | 223 | GJ22745-PA | 3..181 | 5..184 | 183 | 29.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK20320-PA | 213 | GK20320-PA | 1..213 | 1..212 | 1003 | 91.5 | Plus |
Dwil\GK14462-PA | 251 | GK14462-PA | 1..188 | 2..188 | 271 | 36.2 | Plus |
Dwil\GK12139-PA | 229 | GK12139-PA | 3..193 | 5..189 | 188 | 28.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE21483-PA | 212 | GE21483-PA | 1..212 | 1..212 | 1075 | 97.6 | Plus |
Dyak\GE23653-PA | 256 | GE23653-PA | 1..188 | 2..188 | 272 | 36.2 | Plus |
Dyak\GE25363-PA | 223 | GE25363-PA | 3..181 | 5..184 | 176 | 29.1 | Plus |