Clone LD36256 Report

Search the DGRC for LD36256

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:362
Well:56
Vector:pOT2
Associated Gene/TranscriptTaf12-RA
Protein status:LD36256.pep: gold
Preliminary Size:1211
Sequenced Size:1066

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17358 2001-01-01 Release 2 assignment
CG17358 2003-01-01 Sim4 clustering to Release 3
CG17358 2003-08-11 Blastp of sequenced clone
Taf12 2008-04-29 Release 5.5 accounting
Taf12 2008-08-15 Release 5.9 accounting
Taf12 2008-12-18 5.12 accounting

Clone Sequence Records

LD36256.complete Sequence

1066 bp (1066 high quality bases) assembled on 2003-08-11

GenBank Submission: AY061435

> LD36256.complete
CCATACTGTTGATTTGGCTGTAGTTGCTCCGCTTATTTTTATTTTGTTTA
GTAATTTAGGAAAGTAATAGTTTAAGATCAAAGTGTTAAAACCGCAATAA
TTTTGAGAAAGCAGGAGGACACACAACATAAGCAGCAACAACAACAAGTA
CACTAACGCTTTTGGCTTTGGTTCTGCACTCTTACCCACTCCCCAAAAAT
CCGCCCAACTTACTGTACTTTCCCCAAACACTTCCAACCAACCGACCTAC
CACCCACTTGATTTGACTCTGAAGAAACCCAAAAGCAATGTCGGATCTCT
TTACCACTTTCGATAGCAACGGCGTCGCCGAGCACCACCTGCACCACAAC
CACAACTCCACATCGTCCGCCAGCGGACTGCTCCACGACCCACCCATGGC
CTCGCCCTCCCAGCACAGTCCGATGACCAACAACAGCAACTCATCCTCGC
AGAACGGCGGACCGGTTTCCGGTTTGGGTACGGGAACGGGCCCCATATCT
GGTGGTAGCAAGTCATCCAATCACACATCATCCGCCGCCGGTTCCGAGAA
CACTCCCATGCTTACCAAACCGCGTCTCACAGAGCTCGTCCGAGAGGTGG
ATACCACCACGCAGCTGGACGAGGATGTTGAGGAGCTTCTGCTTCAGATC
ATCGACGACTTTGTCGAGGACACCGTCAAGTCGACGAGCGCCTTCGCCAA
GCACCGAAAGTCTAACAAGATCGAGGTGCGCGACGTGCAGCTGCACTTTG
AGCGGAAGTACAACATGTGGATACCCGGCTTCGGTACGGACGAACTGCGT
CCCTACAAGCGGGCAGCTGTCACGGAGGCGCACAAACAGCGCCTTGCCCT
CATACGGAAAACGATCAAGAAATACTAGAGGATTGGATCTAATCGGGTCG
AGGCTCTGTTTCGGTTTGCCGGATTTCGCGTATGCTAAACGTGCACACGC
CACAAACTAATTTAAGCTCCAATTTAGATTAAATAACAAATTATCGTCGC
TCTATTGTAGATTTATTGTAATAAAAGTGCACTATTGATTTCACAAAAAA
AAAAAAAAAAAAAAAA

LD36256.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:32:15
Subject Length Description Subject Range Query Range Score Percent Strand
Taf12-RB 1080 Taf12-RB 28..1072 1..1045 5225 100 Plus
Taf12-RA 1248 Taf12-RA 298..1240 103..1045 4715 100 Plus
Taf12-RD 875 Taf12-RD 139..867 317..1045 3645 100 Plus
Taf12-RA 1248 Taf12-RA 28..129 1..102 510 100 Plus
Taf12-RD 875 Taf12-RD 37..138 1..102 510 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:14:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 7503919..7504405 1044..558 2435 100 Minus
chr3R 27901430 chr3R 7504477..7504931 557..103 2275 100 Minus
chr3R 27901430 chr3R 7505100..7505201 102..1 510 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:31:05 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:14:53
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11678385..11678872 1045..558 2440 100 Minus
3R 32079331 3R 11678944..11679398 557..103 2275 100 Minus
3R 32079331 3R 11679567..11679668 102..1 510 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:00:24
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 11419216..11419703 1045..558 2440 100 Minus
3R 31820162 3R 11419775..11420229 557..103 2275 100 Minus
3R 31820162 3R 11420398..11420499 102..1 510 100 Minus
Blast to na_te.dros performed 2019-03-16 11:14:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 5651..5686 123..158 126 83.3 Plus

LD36256.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:15:40 Download gff for LD36256.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 7503919..7504405 558..1044 100 <- Minus
chr3R 7504477..7504931 103..557 100 <- Minus
chr3R 7505100..7505201 1..102 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:18:45 Download gff for LD36256.complete
Subject Subject Range Query Range Percent Splice Strand
Taf12-RA 1..591 288..878 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:53:13 Download gff for LD36256.complete
Subject Subject Range Query Range Percent Splice Strand
Taf12-RA 1..591 288..878 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:37:42 Download gff for LD36256.complete
Subject Subject Range Query Range Percent Splice Strand
Taf12-RB 1..591 288..878 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:18:42 Download gff for LD36256.complete
Subject Subject Range Query Range Percent Splice Strand
Taf12-RA 1..591 288..878 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:09:01 Download gff for LD36256.complete
Subject Subject Range Query Range Percent Splice Strand
Taf12-RB 1..591 288..878 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:16:42 Download gff for LD36256.complete
Subject Subject Range Query Range Percent Splice Strand
Taf12-RB 19..1062 1..1044 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:53:13 Download gff for LD36256.complete
Subject Subject Range Query Range Percent Splice Strand
Taf12-RB 19..1062 1..1044 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:37:42 Download gff for LD36256.complete
Subject Subject Range Query Range Percent Splice Strand
Taf12-RB 23..1066 1..1044 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:18:42 Download gff for LD36256.complete
Subject Subject Range Query Range Percent Splice Strand
Taf12-RB 19..1062 1..1044 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:09:01 Download gff for LD36256.complete
Subject Subject Range Query Range Percent Splice Strand
Taf12-RB 23..1066 1..1044 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:15:40 Download gff for LD36256.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11678386..11678872 558..1044 100 <- Minus
3R 11678944..11679398 103..557 100 <- Minus
3R 11679567..11679668 1..102 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:15:40 Download gff for LD36256.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11678386..11678872 558..1044 100 <- Minus
3R 11678944..11679398 103..557 100 <- Minus
3R 11679567..11679668 1..102 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:15:40 Download gff for LD36256.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11678386..11678872 558..1044 100 <- Minus
3R 11678944..11679398 103..557 100 <- Minus
3R 11679567..11679668 1..102 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:37:42 Download gff for LD36256.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7504108..7504594 558..1044 100 <- Minus
arm_3R 7504666..7505120 103..557 100 <- Minus
arm_3R 7505289..7505390 1..102 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:52:57 Download gff for LD36256.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11419217..11419703 558..1044 100 <- Minus
3R 11419775..11420229 103..557 100 <- Minus
3R 11420398..11420499 1..102 100   Minus

LD36256.pep Sequence

Translation from 287 to 877

> LD36256.pep
MSDLFTTFDSNGVAEHHLHHNHNSTSSASGLLHDPPMASPSQHSPMTNNS
NSSSQNGGPVSGLGTGTGPISGGSKSSNHTSSAAGSENTPMLTKPRLTEL
VREVDTTTQLDEDVEELLLQIIDDFVEDTVKSTSAFAKHRKSNKIEVRDV
QLHFERKYNMWIPGFGTDELRPYKRAAVTEAHKQRLALIRKTIKKY*

LD36256.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 02:22:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16626-PA 190 GF16626-PA 1..190 1..196 751 83.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 02:22:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17205-PA 198 GG17205-PA 1..198 1..196 1000 97 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 02:22:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19321-PA 191 GH19321-PA 1..191 1..196 637 73 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:09
Subject Length Description Subject Range Query Range Score Percent Strand
Taf12-PA 196 CG17358-PA 1..196 1..196 1018 100 Plus
Taf12-PB 196 CG17358-PB 1..196 1..196 1018 100 Plus
Taf12-PE 160 CG17358-PE 1..160 37..196 819 100 Plus
Taf12-PD 160 CG17358-PD 1..160 37..196 819 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 02:22:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23544-PA 193 GI23544-PA 1..193 1..196 681 71.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 02:22:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12259-PA 187 GL12259-PA 1..187 1..196 693 83.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 02:22:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14477-PA 187 GA14477-PA 1..187 1..196 693 83.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 02:22:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26083-PA 194 GM26083-PA 1..194 1..196 987 96.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 02:22:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20646-PA 194 GD20646-PA 1..194 1..196 997 97.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 02:22:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10291-PA 194 GJ10291-PA 1..194 1..196 675 71.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 02:22:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11997-PA 185 GK11997-PA 1..185 1..196 718 78 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 02:22:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10098-PA 198 GE10098-PA 1..198 1..196 991 96.5 Plus

LD36256.hyp Sequence

Translation from 287 to 877

> LD36256.hyp
MSDLFTTFDSNGVAEHHLHHNHNSTSSASGLLHDPPMASPSQHSPMTNNS
NSSSQNGGPVSGLGTGTGPISGGSKSSNHTSSAAGSENTPMLTKPRLTEL
VREVDTTTQLDEDVEELLLQIIDDFVEDTVKSTSAFAKHRKSNKIEVRDV
QLHFERKYNMWIPGFGTDELRPYKRAAVTEAHKQRLALIRKTIKKY*

LD36256.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:11:09
Subject Length Description Subject Range Query Range Score Percent Strand
Taf12-PA 196 CG17358-PA 1..196 1..196 1018 100 Plus
Taf12-PB 196 CG17358-PB 1..196 1..196 1018 100 Plus
Taf12-PE 160 CG17358-PE 1..160 37..196 819 100 Plus
Taf12-PD 160 CG17358-PD 1..160 37..196 819 100 Plus