Clone LD36516 Report

Search the DGRC for LD36516

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:365
Well:16
Vector:pOT2
Associated Gene/Transcriptprel-RB
Protein status:LD36516.pep: gold
Preliminary Size:1664
Sequenced Size:1545

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8806 2001-10-10 Blastp of sequenced clone
CG8806 2003-01-01 Sim4 clustering to Release 3
prel 2008-04-29 Release 5.5 accounting
prel 2008-08-15 Release 5.9 accounting
prel 2008-12-18 5.12 accounting

Clone Sequence Records

LD36516.complete Sequence

1545 bp (1545 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061437

> LD36516.complete
GCCTTTGAACAGGCGTAAATTGTATCCAAATTGGCAGCAAACCCTTGGAA
AGCAAGCAATGAAACCGTGTACAGACAGGAGAAGGGGGCACTGAAGGTCG
AGGCAACGCAGGAATCGAGGGATATCGCCAGCAAATTGCCAGAAATTGAA
GGCGCCCAAAGTCGGGGCAACAACAAGCTGCTAGCTGAATCAACGTGTGC
CAGCTAATTGGTGCCAATCACACTGCACTCTGGAGCTCTAAAACCGTAAG
AGACCCCCGTTCTTGGACCCCCTCGCAAAGATCAGGGACACGGCGGCTTT
CACTTTCGAACACATCGGCGAGTTCATTGGTCCACCTTCAACATGGTCGT
GGCAGCATCCACCTGCCGCACGGAGACGGTCTTCGATTACAGCTGGATGA
ACGTGGTGGTCGCCTACTGGAACCGCTACCCGAATCCCTCAAGCACGCAC
GTCCTCACCGAGGACACTATTCAGCGGGAGGTGCGCGATGGCAAGCTCTT
CTCGCGCCGGCTGCTCTCCAAGACGAATCCGGTGCCGAAGTGGGGAGCTC
GCTTCTACAACAATGTGCCGGTCAAGATTGTTGAGGACTCCGTGCTGGAC
CCGGTTAAAAAGACATTCACCACTTTCACCAGGAACCTGGGAATGACCAA
GATAATGAAAGTCGATGAAATTGTCGTCTACAGCGAGCAGAAGGATGGTA
GTACTCTGGCGGTGCGAAGAGCATACATTAGTTCGCAGGTGTTCGGATTC
TCGCGGGCCATTCGCGCCTTCGGCATCGAACGGTTTAAGGCCAATGGCAA
CAAGGCCTCCAATGGATTCAACTACGTGCTGCGGCGCATGTTTCCGGACA
GTTTGGTTGGTGGAGGACATCACCAGCACGCGGTGACGACGACTTCGCCA
GCTGGAGAACTTCCTGCAACGACCATCACCGTATCCACAACAAACGGCAG
TCTCAACAACCAAGGAGCTCTCAAGAGCGCCGCAAAAGTGGGCTACGAGT
TCTTCAAGAGTCATGCCTCCAAGATTGCGCAACTGTTTTCTGTCAAGAAC
TGAGGAACTTCTAGTCTGTACTTTTTGGAATAGATGTCGAATGGGACCGA
AGATTTTAATGCTTTCGGCTCCGGGAGTTAAGGAGTTTGTGGATTTGACC
AGGACGGAATTAGAATGACGAGCGGAGGAGTCGTGTCGCCGGGTGTTTTT
AAACATTTATTCCAAAGCAAATCCAACTACATACTTTGCTGCATTTCATT
CCGTGTGTGCGCGAATCAAACGGCTGATCTGAACGGAGACACAATTTGCT
GAACACATTTCCTGCATGCTACCAAATTCTATTATTTATCGTTACTTATT
TGCACTACATTATTATGTATCATTCTGTTAGGTCAAGAGCAGGAAATGAA
AAGCCGTGTCAAAATTGGTATTGCTATGTAATATGTTGTATATTTTTATC
AAAATATAAGAAAACCAACACTTGTAGTGGTTAAAAGTGTAGTTATTAAA
ATAAACTTAGTCTGTTAGAAAAAAAAAAAAAAAAAAAAAAAAAAA

LD36516.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:13:37
Subject Length Description Subject Range Query Range Score Percent Strand
prel-RB 1646 prel-RB 82..1602 1..1521 7605 100 Plus
prel.a 1649 prel.a 82..1605 1..1521 7550 99.8 Plus
prel.b 1531 prel.b 294..1531 281..1518 6190 100 Plus
prel.b 1531 prel.b 46..293 1..245 1170 98.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:58:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 5312750..5313611 657..1518 4265 99.7 Plus
chr2R 21145070 chr2R 5312041..5312419 279..657 1880 99.7 Plus
chr2R 21145070 chr2R 5311620..5311771 1..152 760 100 Plus
chr2R 21145070 chr2R 5311834..5311964 150..280 655 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:31:22 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:57:58
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9425246..9426110 657..1521 4325 100 Plus
2R 25286936 2R 9424537..9424915 279..657 1895 100 Plus
2R 25286936 2R 9424116..9424267 1..152 760 100 Plus
2R 25286936 2R 9424330..9424460 150..280 655 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:37:25
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 9426445..9427309 657..1521 4325 100 Plus
2R 25260384 2R 9425736..9426114 279..657 1895 100 Plus
2R 25260384 2R 9425315..9425466 1..152 760 100 Plus
2R 25260384 2R 9425529..9425659 150..280 655 100 Plus
Blast to na_te.dros performed on 2019-03-16 10:57:58 has no hits.

LD36516.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:59:02 Download gff for LD36516.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 5311620..5311770 1..151 100 -> Plus
chr2R 5311836..5311964 152..280 100 -> Plus
chr2R 5312043..5312419 281..657 99 -> Plus
chr2R 5312751..5313611 658..1518 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:19:02 Download gff for LD36516.complete
Subject Subject Range Query Range Percent Splice Strand
prel-RB 1..711 343..1053 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:54:00 Download gff for LD36516.complete
Subject Subject Range Query Range Percent Splice Strand
prel-RB 1..711 343..1053 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:38:33 Download gff for LD36516.complete
Subject Subject Range Query Range Percent Splice Strand
prel-RC 1..711 343..1053 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:23:03 Download gff for LD36516.complete
Subject Subject Range Query Range Percent Splice Strand
prel-RA 1..711 343..1053 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:21:53 Download gff for LD36516.complete
Subject Subject Range Query Range Percent Splice Strand
prel-RC 1..711 343..1053 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:39:21 Download gff for LD36516.complete
Subject Subject Range Query Range Percent Splice Strand
prel-RB 46..1563 1..1518 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:54:00 Download gff for LD36516.complete
Subject Subject Range Query Range Percent Splice Strand
prel-RB 46..1563 1..1518 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:38:33 Download gff for LD36516.complete
Subject Subject Range Query Range Percent Splice Strand
prel-RB 30..1547 1..1518 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:23:03 Download gff for LD36516.complete
Subject Subject Range Query Range Percent Splice Strand
prel-RA 46..1563 1..1518 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:21:53 Download gff for LD36516.complete
Subject Subject Range Query Range Percent Splice Strand
prel-RB 30..1547 1..1518 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:59:02 Download gff for LD36516.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9424332..9424460 152..280 100 -> Plus
2R 9424116..9424266 1..151 100 -> Plus
2R 9424539..9424915 281..657 100 -> Plus
2R 9425247..9426107 658..1518 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:59:02 Download gff for LD36516.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9424332..9424460 152..280 100 -> Plus
2R 9424116..9424266 1..151 100 -> Plus
2R 9424539..9424915 281..657 100 -> Plus
2R 9425247..9426107 658..1518 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:59:02 Download gff for LD36516.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9424332..9424460 152..280 100 -> Plus
2R 9424116..9424266 1..151 100 -> Plus
2R 9424539..9424915 281..657 100 -> Plus
2R 9425247..9426107 658..1518 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:38:33 Download gff for LD36516.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5311621..5311771 1..151 100 -> Plus
arm_2R 5311837..5311965 152..280 100 -> Plus
arm_2R 5312044..5312420 281..657 100 -> Plus
arm_2R 5312752..5313612 658..1518 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:00:08 Download gff for LD36516.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9425738..9426114 281..657 100 -> Plus
2R 9426446..9427306 658..1518 100   Plus
2R 9425315..9425465 1..151 100 -> Plus
2R 9425531..9425659 152..280 100 -> Plus

LD36516.pep Sequence

Translation from 342 to 1052

> LD36516.pep
MVVAASTCRTETVFDYSWMNVVVAYWNRYPNPSSTHVLTEDTIQREVRDG
KLFSRRLLSKTNPVPKWGARFYNNVPVKIVEDSVLDPVKKTFTTFTRNLG
MTKIMKVDEIVVYSEQKDGSTLAVRRAYISSQVFGFSRAIRAFGIERFKA
NGNKASNGFNYVLRRMFPDSLVGGGHHQHAVTTTSPAGELPATTITVSTT
NGSLNNQGALKSAAKVGYEFFKSHASKIAQLFSVKN*

LD36516.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:47:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12463-PA 236 GF12463-PA 1..236 1..236 1044 84.8 Plus
Dana\GF15409-PA 222 GF15409-PA 6..162 10..163 180 26.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:47:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24072-PA 236 GG24072-PA 1..236 1..236 1160 94.5 Plus
Dere\GG10142-PA 215 GG10142-PA 6..162 10..163 177 26.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:47:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23146-PA 231 GH23146-PA 1..231 1..236 955 77.5 Plus
Dgri\GH10939-PA 219 GH10939-PA 6..162 10..163 173 26.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:56:06
Subject Length Description Subject Range Query Range Score Percent Strand
prel-PB 236 CG8806-PB 1..236 1..236 1217 100 Plus
prel-PC 236 CG8806-PC 1..236 1..236 1217 100 Plus
slmo-PE 215 CG9131-PE 6..162 10..163 173 26.1 Plus
slmo-PD 215 CG9131-PD 6..162 10..163 173 26.1 Plus
slmo-PC 215 CG9131-PC 6..162 10..163 173 26.1 Plus
slmo-PB 215 CG9131-PB 6..162 10..163 173 26.1 Plus
slmo-PA 215 CG9131-PA 6..162 10..163 173 26.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:47:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18483-PA 238 GI18483-PA 1..238 1..236 962 76.9 Plus
Dmoj\GI13532-PA 219 GI13532-PA 6..162 10..163 174 26.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:47:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11074-PA 236 GL11074-PA 1..236 1..236 937 74.6 Plus
Dper\GL19083-PA 219 GL19083-PA 6..162 10..163 170 26.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:47:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21334-PA 236 GA21334-PA 1..236 1..236 937 74.6 Plus
Dpse\GA21566-PA 219 GA21566-PA 6..162 10..163 170 26.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:47:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21121-PA 236 GM21121-PA 1..236 1..236 1239 98.3 Plus
Dsec\GM17966-PA 215 GM17966-PA 6..162 10..163 177 26.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:47:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10654-PA 188 GD10654-PA 1..188 1..236 929 78.4 Plus
Dsim\GD22604-PA 215 GD22604-PA 6..162 10..163 177 26.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:47:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21344-PA 231 GJ21344-PA 1..231 1..236 949 79.3 Plus
Dvir\GJ12173-PA 219 GJ12173-PA 6..162 10..163 172 25.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:47:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10633-PA 233 GK10633-PA 1..233 1..236 967 78.8 Plus
Dwil\GK15396-PA 219 GK15396-PA 6..162 10..163 171 24.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:47:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19276-PA 236 GE19276-PA 1..236 1..236 1167 95.3 Plus
Dyak\kisir-PA 215 GE18952-PA 6..162 10..163 177 26.1 Plus

LD36516.hyp Sequence

Translation from 342 to 1052

> LD36516.hyp
MVVAASTCRTETVFDYSWMNVVVAYWNRYPNPSSTHVLTEDTIQREVRDG
KLFSRRLLSKTNPVPKWGARFYNNVPVKIVEDSVLDPVKKTFTTFTRNLG
MTKIMKVDEIVVYSEQKDGSTLAVRRAYISSQVFGFSRAIRAFGIERFKA
NGNKASNGFNYVLRRMFPDSLVGGGHHQHAVTTTSPAGELPATTITVSTT
NGSLNNQGALKSAAKVGYEFFKSHASKIAQLFSVKN*

LD36516.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:42:51
Subject Length Description Subject Range Query Range Score Percent Strand
prel-PB 236 CG8806-PB 1..236 1..236 1217 100 Plus
prel-PC 236 CG8806-PC 1..236 1..236 1217 100 Plus
slmo-PE 215 CG9131-PE 6..162 10..163 173 26.1 Plus
slmo-PD 215 CG9131-PD 6..162 10..163 173 26.1 Plus
slmo-PC 215 CG9131-PC 6..162 10..163 173 26.1 Plus