Clone LD36705 Report

Search the DGRC for LD36705

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:367
Well:5
Vector:pOT2
Associated Gene/TranscriptDlc90F-RA
Protein status:LD36705.pep: gold
Preliminary Size:944
Sequenced Size:820

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12363 2001-01-01 Release 2 assignment
CG12363 2003-01-01 Sim4 clustering to Release 3
CG12363 2003-05-21 Blastp of sequenced clone
Dlc90F 2008-04-29 Release 5.5 accounting
Dlc90F 2008-08-15 Release 5.9 accounting
Dlc90F 2008-12-18 5.12 accounting

Clone Sequence Records

LD36705.complete Sequence

820 bp (820 high quality bases) assembled on 2003-05-21

GenBank Submission: AY069608

> LD36705.complete
CTTTCCGCATCCCTTAGAAAAATAGAATCCCGATATATATTATTTGGACT
GCTCGAACGCCGCCGACGAGCCCAAAAACGCGCGCACATTTACAACGACA
ACAATACAAACTTGAGCTCAGTACGTAAACTTTTTTTGACCAGCTGCCGT
TAGAAGCAAATCAAAGCTGCGACGATGGATGACTCACGCGAAGAAAGCCA
GTTCATTGTGGACGACGTGAGCAAGACGATTAAAGAGGCCATCGAGACGA
CCATCGGCGGTAACGCCTACCAGCACGACAAGGTGAACAACTGGACCGGC
CAGGTGGTGGAGAACTGCCTGACGGTGCTCACCAAGGAGCAGAAGCCCTA
CAAGTACATTGTGACCGCCATGATCATGCAAAAGAACGGTGCTGGACTCC
ACACCGCCAGCTCCTGCTACTGGAACAACGACACCGACGGATCGTGCACA
GTACGCTGGGAGAACAAGACCATGTACTGCATCGTTTCGGTCTTCGGACT
GGCCGTCTAGAGTGGAGGAATGGCAGGACTGCCGGAATTCGCGATGAAGA
TGACTTAAAAGGGGGAGGGACTAACAAGATTGCCGTCGTACACCAGCACA
CACCAACAACACAAATACCATACTTTTTTGATCGGCCATCCATCCTGCTG
TAATAACAAAATTTATTATGGAGCACTTGAAAACCTTGTCGTCACTTCCA
AGCAATTAGCAAGCAACTATTCCGTTGCCAGTGTACTCGCCTAATGTTAT
TCTTGATTTTCAATCTAAAAACGTAAATAAAAAGTGTATAATACCGTAAA
AAAAAAAAAAAAAAAAAAAA

LD36705.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:42:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dlc90F-RA 840 Dlc90F-RA 45..840 1..797 3945 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:58:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 14123537..14124332 1..797 3890 99.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:31:32 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:58:06
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18299249..18300045 1..798 3940 99.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:03:32
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 18040080..18040876 1..798 3950 99.8 Plus
Blast to na_te.dros performed on 2019-03-16 10:58:06 has no hits.

LD36705.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:59:07 Download gff for LD36705.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 14123537..14124332 1..797 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:19:11 Download gff for LD36705.complete
Subject Subject Range Query Range Percent Splice Strand
Dlc90F-RA 1..336 175..510 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:35:46 Download gff for LD36705.complete
Subject Subject Range Query Range Percent Splice Strand
Dlc90F-RA 1..336 175..510 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:39:09 Download gff for LD36705.complete
Subject Subject Range Query Range Percent Splice Strand
Dlc90F-RA 1..336 175..510 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:11:42 Download gff for LD36705.complete
Subject Subject Range Query Range Percent Splice Strand
Dlc90F-RA 1..336 175..510 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:22:01 Download gff for LD36705.complete
Subject Subject Range Query Range Percent Splice Strand
Dlc90F-RA 1..336 175..510 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:38:51 Download gff for LD36705.complete
Subject Subject Range Query Range Percent Splice Strand
Dlc90F-RA 45..838 1..795 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:35:46 Download gff for LD36705.complete
Subject Subject Range Query Range Percent Splice Strand
Dlc90F-RA 45..838 1..795 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:39:09 Download gff for LD36705.complete
Subject Subject Range Query Range Percent Splice Strand
Dlc90F-RA 21..816 1..797 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:11:42 Download gff for LD36705.complete
Subject Subject Range Query Range Percent Splice Strand
Dlc90F-RA 45..838 1..795 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:22:01 Download gff for LD36705.complete
Subject Subject Range Query Range Percent Splice Strand
Dlc90F-RA 21..816 1..797 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:59:07 Download gff for LD36705.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18299249..18300044 1..797 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:59:07 Download gff for LD36705.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18299249..18300044 1..797 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:59:07 Download gff for LD36705.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18299249..18300044 1..797 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:39:09 Download gff for LD36705.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14124971..14125766 1..797 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:48:07 Download gff for LD36705.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18040080..18040875 1..797 99   Plus

LD36705.pep Sequence

Translation from 174 to 509

> LD36705.pep
MDDSREESQFIVDDVSKTIKEAIETTIGGNAYQHDKVNNWTGQVVENCLT
VLTKEQKPYKYIVTAMIMQKNGAGLHTASSCYWNNDTDGSCTVRWENKTM
YCIVSVFGLAV*

LD36705.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:58:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16899-PA 111 GF16899-PA 1..111 1..111 586 99.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:58:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22848-PA 111 GG22848-PA 1..111 1..111 592 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:58:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18339-PA 111 GH18339-PA 1..111 1..111 592 100 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:41:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dlc90F-PA 111 CG12363-PA 1..111 1..111 596 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:58:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23319-PA 111 GI23319-PA 1..111 1..111 589 99.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:58:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23856-PA 111 GL23856-PA 1..111 1..111 592 100 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:58:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27080-PA 111 GA27080-PA 1..111 1..111 592 100 Plus
Dpse\GA25489-PA 111 GA25489-PA 1..111 1..111 592 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:58:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15301-PA 111 GM15301-PA 1..111 1..111 592 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:58:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19225-PA 111 GD19225-PA 1..111 1..111 592 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:58:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10323-PA 111 GJ10323-PA 1..111 1..111 589 99.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:58:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11595-PA 111 GK11595-PA 1..111 1..111 592 100 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:58:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25532-PA 111 GE25532-PA 1..111 1..111 592 100 Plus

LD36705.hyp Sequence

Translation from 174 to 509

> LD36705.hyp
MDDSREESQFIVDDVSKTIKEAIETTIGGNAYQHDKVNNWTGQVVENCLT
VLTKEQKPYKYIVTAMIMQKNGAGLHTASSCYWNNDTDGSCTVRWENKTM
YCIVSVFGLAV*

LD36705.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:38:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dlc90F-PA 111 CG12363-PA 1..111 1..111 596 100 Plus