BDGP Sequence Production Resources |
Search the DGRC for LD36705
Library: | LD |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Ling Hong |
Date Registered: | 1997-12-04 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 367 |
Well: | 5 |
Vector: | pOT2 |
Associated Gene/Transcript | Dlc90F-RA |
Protein status: | LD36705.pep: gold |
Preliminary Size: | 944 |
Sequenced Size: | 820 |
Gene | Date | Evidence |
---|---|---|
CG12363 | 2001-01-01 | Release 2 assignment |
CG12363 | 2003-01-01 | Sim4 clustering to Release 3 |
CG12363 | 2003-05-21 | Blastp of sequenced clone |
Dlc90F | 2008-04-29 | Release 5.5 accounting |
Dlc90F | 2008-08-15 | Release 5.9 accounting |
Dlc90F | 2008-12-18 | 5.12 accounting |
820 bp (820 high quality bases) assembled on 2003-05-21
GenBank Submission: AY069608
> LD36705.complete CTTTCCGCATCCCTTAGAAAAATAGAATCCCGATATATATTATTTGGACT GCTCGAACGCCGCCGACGAGCCCAAAAACGCGCGCACATTTACAACGACA ACAATACAAACTTGAGCTCAGTACGTAAACTTTTTTTGACCAGCTGCCGT TAGAAGCAAATCAAAGCTGCGACGATGGATGACTCACGCGAAGAAAGCCA GTTCATTGTGGACGACGTGAGCAAGACGATTAAAGAGGCCATCGAGACGA CCATCGGCGGTAACGCCTACCAGCACGACAAGGTGAACAACTGGACCGGC CAGGTGGTGGAGAACTGCCTGACGGTGCTCACCAAGGAGCAGAAGCCCTA CAAGTACATTGTGACCGCCATGATCATGCAAAAGAACGGTGCTGGACTCC ACACCGCCAGCTCCTGCTACTGGAACAACGACACCGACGGATCGTGCACA GTACGCTGGGAGAACAAGACCATGTACTGCATCGTTTCGGTCTTCGGACT GGCCGTCTAGAGTGGAGGAATGGCAGGACTGCCGGAATTCGCGATGAAGA TGACTTAAAAGGGGGAGGGACTAACAAGATTGCCGTCGTACACCAGCACA CACCAACAACACAAATACCATACTTTTTTGATCGGCCATCCATCCTGCTG TAATAACAAAATTTATTATGGAGCACTTGAAAACCTTGTCGTCACTTCCA AGCAATTAGCAAGCAACTATTCCGTTGCCAGTGTACTCGCCTAATGTTAT TCTTGATTTTCAATCTAAAAACGTAAATAAAAAGTGTATAATACCGTAAA AAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dlc90F-RA | 840 | Dlc90F-RA | 45..840 | 1..797 | 3945 | 99.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 14123537..14124332 | 1..797 | 3890 | 99.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 18299249..18300045 | 1..798 | 3940 | 99.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 18040080..18040876 | 1..798 | 3950 | 99.8 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 14123537..14124332 | 1..797 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Dlc90F-RA | 1..336 | 175..510 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Dlc90F-RA | 1..336 | 175..510 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Dlc90F-RA | 1..336 | 175..510 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Dlc90F-RA | 1..336 | 175..510 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Dlc90F-RA | 1..336 | 175..510 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Dlc90F-RA | 45..838 | 1..795 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Dlc90F-RA | 45..838 | 1..795 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Dlc90F-RA | 21..816 | 1..797 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Dlc90F-RA | 45..838 | 1..795 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Dlc90F-RA | 21..816 | 1..797 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 18299249..18300044 | 1..797 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 18299249..18300044 | 1..797 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 18299249..18300044 | 1..797 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 14124971..14125766 | 1..797 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 18040080..18040875 | 1..797 | 99 | Plus |
Translation from 174 to 509
> LD36705.pep MDDSREESQFIVDDVSKTIKEAIETTIGGNAYQHDKVNNWTGQVVENCLT VLTKEQKPYKYIVTAMIMQKNGAGLHTASSCYWNNDTDGSCTVRWENKTM YCIVSVFGLAV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF16899-PA | 111 | GF16899-PA | 1..111 | 1..111 | 586 | 99.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22848-PA | 111 | GG22848-PA | 1..111 | 1..111 | 592 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18339-PA | 111 | GH18339-PA | 1..111 | 1..111 | 592 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dlc90F-PA | 111 | CG12363-PA | 1..111 | 1..111 | 596 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23319-PA | 111 | GI23319-PA | 1..111 | 1..111 | 589 | 99.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL23856-PA | 111 | GL23856-PA | 1..111 | 1..111 | 592 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA27080-PA | 111 | GA27080-PA | 1..111 | 1..111 | 592 | 100 | Plus |
Dpse\GA25489-PA | 111 | GA25489-PA | 1..111 | 1..111 | 592 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM15301-PA | 111 | GM15301-PA | 1..111 | 1..111 | 592 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD19225-PA | 111 | GD19225-PA | 1..111 | 1..111 | 592 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ10323-PA | 111 | GJ10323-PA | 1..111 | 1..111 | 589 | 99.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK11595-PA | 111 | GK11595-PA | 1..111 | 1..111 | 592 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE25532-PA | 111 | GE25532-PA | 1..111 | 1..111 | 592 | 100 | Plus |
Translation from 174 to 509
> LD36705.hyp MDDSREESQFIVDDVSKTIKEAIETTIGGNAYQHDKVNNWTGQVVENCLT VLTKEQKPYKYIVTAMIMQKNGAGLHTASSCYWNNDTDGSCTVRWENKTM YCIVSVFGLAV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dlc90F-PA | 111 | CG12363-PA | 1..111 | 1..111 | 596 | 100 | Plus |