Clone LD36817 Report

Search the DGRC for LD36817

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:368
Well:17
Vector:pOT2
Associated Gene/TranscriptCG6347-RA
Protein status:LD36817.pep: gold
Preliminary Size:1352
Sequenced Size:1318

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6347 2001-01-01 Release 2 assignment
CG6347 2003-01-01 Sim4 clustering to Release 3
CG6347 2003-02-22 Blastp of sequenced clone
CG6347 2008-04-29 Release 5.5 accounting
CG6347 2008-08-15 Release 5.9 accounting
CG6347 2008-12-18 5.12 accounting

Clone Sequence Records

LD36817.complete Sequence

1318 bp (1318 high quality bases) assembled on 2003-02-22

GenBank Submission: AY069609

> LD36817.complete
CGCCGGTCTTCGAGTCTTCAGCATCTTCGAATAGTTTTGTGATTTGTGAA
CGCGGAAGGTGTTTTGAACATATCATTCCCAGATATCCATAAAAGATGCG
GATGTGCTCAACGATGTGGCTGCAGATGACGCTGGGACTGGCCCTGCTGG
GTGCTGTGTCATTGCAGCAACTGCAGTCGTTTCCCAAGCTCTGCGATGTG
CAAAACTTCGACGACTTCCTCCGGCAGACGGGCAAGGTGTACTCGGATGA
GGAGCGAGTCTATCGCGAGAGCATCTTCGCGGCCAAGATGTCGCTGATCA
CGCTGAGCAATAAGAACGCCGACAACGGCGTGTCCGGATTCCGGCTGGGC
GTCAATACGCTGGCCGACATGACCAGAAAGGAGATAGCCACCTTGCTGGG
CTCCAAAATCTCCGAATTTGGCGAGAGATATACGAATGGCCATATCAACT
TTGTGACTGCCAGGAATCCGGCGAGTGCCAATCTTCCCGAGATGTTCGAT
TGGCGCGAGAAGGGCGGAGTGACGCCACCGGGATTCCAGGGTGTGGGATG
CGGTGCCTGCTGGTCGTTCGCCACCACAGGAGCGCTCGAAGGACATCTAT
TCCGGCGGACTGGAGTGCTGGCCTCGCTGTCGCAGCAGAATCTGGTGGAC
TGTGCCGATGACTACGGCAACATGGGCTGTGACGGTGGCTTCCAGGAGTA
CGGTTTCGAGTACATACGCGATCACGGTGTAACGCTGGCCAACAAATATC
CGTACACACAGACGGAGATGCAGTGCCGTCAGAACGAAACCGCCGGACGT
CCACCGCGCGAGAGTCTGGTGAAAATTCGCGATTATGCCACCATTACTCC
CGGGGATGAGGAGAAGATGAAGGAGGTGATTGCCACGTTGGGACCGTTGG
CGTGCTCCATGAACGCGGACACCATTTCGTTTGAGCAGTACAGCGGTGGC
ATCTACGAGGACGAGGAGTGCAATCAGGGCGAACTGAATCACTCGGTAAC
CGTGGTGGGCTATGGAACGGAAAATGGACGCGACTACTGGATCATCAAGA
ACTCGTACTCTCAGAATTGGGGCGAGGGCGGCTTTATGCGCATCCTCCGG
AATGCAGGTGGATTCTGCGGCATCGCCAGCGAGTGCAGCTACCCCATTCT
GTAGGCTCACAACTGCGCCATGCAATTAGTTAGATAGTATAGTCAATTAA
AAACCACGAATTTATAACTTTGTTACTGTAGTCGTAAGCTGTGTGGGTCA
CCACATCGATTCCATGAGTCACGCGGTTAATAAATGAAACAAGTGCCTTA
AAAAAAAAAAAAAAAAAA

LD36817.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:19:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG6347-RA 1455 CG6347-RA 128..1427 1..1300 6500 100 Plus
CG6347.a 1274 CG6347.a 69..1274 95..1300 6030 100 Plus
CG6347.b 1229 CG6347.b 25..1229 96..1300 6025 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:03:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 9725838..9726713 425..1299 4210 99 Plus
chr2R 21145070 chr2R 9725063..9725394 94..425 1585 98.5 Plus
chr2R 21145070 chr2R 9723778..9723872 1..95 475 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:31:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:03:46
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 13838489..13839364 425..1300 4380 100 Plus
2R 25286936 2R 13837717..13838048 94..425 1660 100 Plus
2R 25286936 2R 13836432..13836526 1..95 475 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:58:11
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 13839688..13840563 425..1300 4380 100 Plus
2R 25260384 2R 13838916..13839247 94..425 1660 100 Plus
2R 25260384 2R 13837631..13837725 1..95 475 100 Plus
Blast to na_te.dros performed on 2019-03-16 03:03:46 has no hits.

LD36817.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:05:02 Download gff for LD36817.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 9723778..9723872 1..95 100 -> Plus
chr2R 9725065..9725393 96..424 98 -> Plus
chr2R 9725838..9726713 425..1299 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:19:17 Download gff for LD36817.complete
Subject Subject Range Query Range Percent Splice Strand
CG6347-RA 1..1059 96..1154 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:48:57 Download gff for LD36817.complete
Subject Subject Range Query Range Percent Splice Strand
CG6347-RA 1..1059 96..1154 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:38:02 Download gff for LD36817.complete
Subject Subject Range Query Range Percent Splice Strand
CG6347-RA 1..1059 96..1154 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:40:22 Download gff for LD36817.complete
Subject Subject Range Query Range Percent Splice Strand
CG6347-RA 1..1059 96..1154 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:29:35 Download gff for LD36817.complete
Subject Subject Range Query Range Percent Splice Strand
CG6347-RA 1..1059 96..1154 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:01:30 Download gff for LD36817.complete
Subject Subject Range Query Range Percent Splice Strand
CG6347-RA 12..1310 1..1299 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:48:57 Download gff for LD36817.complete
Subject Subject Range Query Range Percent Splice Strand
CG6347-RA 12..1310 1..1299 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:38:02 Download gff for LD36817.complete
Subject Subject Range Query Range Percent Splice Strand
CG6347-RA 14..1312 1..1299 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:40:22 Download gff for LD36817.complete
Subject Subject Range Query Range Percent Splice Strand
CG6347-RA 12..1310 1..1299 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:29:35 Download gff for LD36817.complete
Subject Subject Range Query Range Percent Splice Strand
CG6347-RA 14..1312 1..1299 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:05:02 Download gff for LD36817.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13837719..13838047 96..424 100 -> Plus
2R 13838489..13839363 425..1299 100   Plus
2R 13836432..13836526 1..95 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:05:02 Download gff for LD36817.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13837719..13838047 96..424 100 -> Plus
2R 13838489..13839363 425..1299 100   Plus
2R 13836432..13836526 1..95 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:05:02 Download gff for LD36817.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13837719..13838047 96..424 100 -> Plus
2R 13838489..13839363 425..1299 100   Plus
2R 13836432..13836526 1..95 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:38:02 Download gff for LD36817.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 9723937..9724031 1..95 100 -> Plus
arm_2R 9725224..9725552 96..424 100 -> Plus
arm_2R 9725994..9726868 425..1299 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:10:43 Download gff for LD36817.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13838918..13839246 96..424 100 -> Plus
2R 13839688..13840562 425..1299 100   Plus
2R 13837631..13837725 1..95 100 -> Plus

LD36817.pep Sequence

Translation from 95 to 1153

> LD36817.pep
MRMCSTMWLQMTLGLALLGAVSLQQLQSFPKLCDVQNFDDFLRQTGKVYS
DEERVYRESIFAAKMSLITLSNKNADNGVSGFRLGVNTLADMTRKEIATL
LGSKISEFGERYTNGHINFVTARNPASANLPEMFDWREKGGVTPPGFQGV
GCGACWSFATTGALEGHLFRRTGVLASLSQQNLVDCADDYGNMGCDGGFQ
EYGFEYIRDHGVTLANKYPYTQTEMQCRQNETAGRPPRESLVKIRDYATI
TPGDEEKMKEVIATLGPLACSMNADTISFEQYSGGIYEDEECNQGELNHS
VTVVGYGTENGRDYWIIKNSYSQNWGEGGFMRILRNAGGFCGIASECSYP
IL*

LD36817.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 06:31:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13714-PA 352 GF13714-PA 1..352 1..352 1701 86.9 Plus
Dana\GF13132-PA 392 GF13132-PA 77..392 30..352 711 44.2 Plus
Dana\GF17600-PA 333 GF17600-PA 33..333 41..352 593 41.1 Plus
Dana\GF13722-PA 417 GF13722-PA 114..417 47..352 590 41 Plus
Dana\GF17358-PA 329 GF17358-PA 37..329 47..352 512 37.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 06:31:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20405-PA 352 GG20405-PA 1..352 1..352 1814 93.2 Plus
Dere\GG20691-PA 378 GG20691-PA 58..378 26..352 758 46.7 Plus
Dere\GG20414-PA 341 GG20414-PA 24..341 21..352 620 40.2 Plus
Dere\GG23942-PA 338 GG23942-PA 36..338 38..352 481 33.4 Plus
Dere\GG10644-PA 344 GG10644-PA 47..343 56..352 462 33.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 06:31:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21038-PA 349 GH21038-PA 1..349 1..352 1423 77.1 Plus
Dgri\GH21411-PA 391 GH21411-PA 64..391 14..352 797 47.8 Plus
Dgri\GH23906-PA 358 GH23906-PA 31..358 14..352 794 47.8 Plus
Dgri\GH22826-PA 340 GH22826-PA 3..340 12..352 617 39.5 Plus
Dgri\GH23974-PA 337 GH23974-PA 33..337 36..352 469 32.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:08:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG6347-PA 352 CG6347-PA 1..352 1..352 1883 100 Plus
CG4847-PE 390 CG4847-PE 74..390 30..352 733 46.2 Plus
CG4847-PC 390 CG4847-PC 74..390 30..352 733 46.2 Plus
CG4847-PA 390 CG4847-PA 74..390 30..352 733 46.2 Plus
CG4847-PD 420 CG4847-PD 104..420 30..352 733 46.2 Plus
Cp1-PA 341 CG6692-PA 7..341 15..352 617 39.8 Plus
Cp1-PC 371 CG6692-PC 37..371 15..352 617 39.8 Plus
Cp1-PE 338 CG6692-PE 23..338 35..352 608 40.7 Plus
Cp1-PD 249 CG6692-PD 22..249 120..352 565 46.6 Plus
CG5367-PA 338 CG5367-PA 36..338 38..352 496 34.4 Plus
CG11459-PB 336 CG11459-PB 30..334 38..350 486 34.3 Plus
CG11459-PA 336 CG11459-PA 30..334 38..350 486 34.3 Plus
26-29-p-PA 549 CG8947-PA 245..546 38..349 415 35.1 Plus
CG12163-PB 475 CG12163-PB 169..474 38..352 378 32.6 Plus
CG12163-PA 614 CG12163-PA 308..613 38..352 378 32.6 Plus
CG6337-PB 340 CG6337-PB 25..325 32..337 230 26.4 Plus
CG6337-PA 340 CG6337-PA 25..325 32..337 230 26.4 Plus
Swim-PA 431 CG3074-PA 210..411 152..343 225 32.7 Plus
Swim-PB 431 CG3074-PB 210..411 152..343 225 32.7 Plus
CtsB1-PC 340 CG10992-PC 87..334 130..348 191 29.4 Plus
CtsB1-PA 340 CG10992-PA 87..334 130..348 191 29.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 06:31:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18640-PA 243 GI18640-PA 8..243 116..352 995 75.2 Plus
Dmoj\GI18587-PA 366 GI18587-PA 47..366 26..352 796 49.5 Plus
Dmoj\GI21205-PA 339 GI21205-PA 6..339 16..352 644 41.4 Plus
Dmoj\GI20850-PA 329 GI20850-PA 1..329 11..352 507 35 Plus
Dmoj\GI14103-PA 334 GI14103-PA 1..334 1..352 461 31.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 06:31:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17477-PA 353 GL17477-PA 1..353 1..352 1664 86.4 Plus
Dper\GL11434-PA 372 GL11434-PA 50..372 24..352 805 49.4 Plus
Dper\GL17172-PA 341 GL17172-PA 1..341 9..352 620 38.4 Plus
Dper\GL19003-PA 335 GL19003-PA 1..335 7..352 482 33.1 Plus
Dper\GL24978-PA 338 GL24978-PA 31..338 38..352 474 31.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 06:31:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24205-PA 353 GA24205-PA 1..353 1..352 1664 86.4 Plus
Dpse\GA18475-PA 372 GA18475-PA 50..372 24..352 803 49.1 Plus
Dpse\GA25021-PA 341 GA25021-PA 1..341 9..352 624 38.9 Plus
Dpse\GA25021-PB 319 GA25021-PB 16..319 47..352 600 41 Plus
Dpse\GA23577-PA 338 GA23577-PA 31..338 38..352 469 32.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 06:31:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21493-PA 352 GM21493-PA 1..352 1..352 1878 98.3 Plus
Dsec\GM21790-PA 382 GM21790-PA 66..382 30..352 760 48 Plus
Dsec\GM21500-PA 341 GM21500-PA 24..341 21..352 611 39.8 Plus
Dsec\GM10853-PA 336 GM10853-PA 3..336 6..352 512 34.3 Plus
Dsec\GM10576-PA 336 GM10576-PA 30..336 38..352 488 34.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 06:31:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10987-PA 352 GD10987-PA 1..352 1..352 1884 98.9 Plus
Dsim\GD11280-PA 382 GD11280-PA 66..382 30..352 753 47.4 Plus
Dsim\GD10995-PA 341 GD10995-PA 24..341 21..352 607 39.5 Plus
Dsim\GD19835-PA 336 GD19835-PA 3..336 6..352 515 34.8 Plus
Dsim\GD22268-PA 338 GD22268-PA 36..338 38..352 490 32.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 06:31:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21653-PA 342 GJ21653-PA 13..342 20..352 1465 81.7 Plus
Dvir\GJ20385-PA 370 GJ20385-PA 50..370 25..352 806 49.8 Plus
Dvir\GJ20806-PA 339 GJ20806-PA 1..339 11..352 625 39.7 Plus
Dvir\GJ14012-PA 327 GJ14012-PA 29..327 38..351 483 37 Plus
Dvir\GJ11310-PA 328 GJ11310-PA 8..328 15..352 476 33.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 06:31:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17860-PA 341 GK17860-PA 14..336 16..337 1456 83.3 Plus
Dwil\GK22909-PA 370 GK22909-PA 49..370 25..352 775 47.7 Plus
Dwil\GK22908-PA 381 GK22908-PA 62..381 26..352 716 45.8 Plus
Dwil\GK19626-PA 341 GK19626-PA 1..341 9..352 584 36.4 Plus
Dwil\GK16790-PA 549 GK16790-PA 245..546 38..349 430 35.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 06:31:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12565-PA 353 GE12565-PA 1..353 1..352 1846 96.9 Plus
Dyak\GE11675-PA 384 GE11675-PA 64..384 26..352 753 46.8 Plus
Dyak\GE12574-PA 341 GE12574-PA 24..341 21..352 613 39.8 Plus
Dyak\GE26053-PA 338 GE26053-PA 36..338 38..352 500 34.1 Plus
Dyak\GE10178-PA 336 GE10178-PA 43..336 52..352 498 33.9 Plus

LD36817.hyp Sequence

Translation from 95 to 1153

> LD36817.hyp
MRMCSTMWLQMTLGLALLGAVSLQQLQSFPKLCDVQNFDDFLRQTGKVYS
DEERVYRESIFAAKMSLITLSNKNADNGVSGFRLGVNTLADMTRKEIATL
LGSKISEFGERYTNGHINFVTARNPASANLPEMFDWREKGGVTPPGFQGV
GCGACWSFATTGALEGHLFRRTGVLASLSQQNLVDCADDYGNMGCDGGFQ
EYGFEYIRDHGVTLANKYPYTQTEMQCRQNETAGRPPRESLVKIRDYATI
TPGDEEKMKEVIATLGPLACSMNADTISFEQYSGGIYEDEECNQGELNHS
VTVVGYGTENGRDYWIIKNSYSQNWGEGGFMRILRNAGGFCGIASECSYP
IL*

LD36817.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:12:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG6347-PA 352 CG6347-PA 1..352 1..352 1883 100 Plus
CG4847-PE 390 CG4847-PE 74..390 30..352 733 46.2 Plus
CG4847-PC 390 CG4847-PC 74..390 30..352 733 46.2 Plus
CG4847-PA 390 CG4847-PA 74..390 30..352 733 46.2 Plus
CG4847-PD 420 CG4847-PD 104..420 30..352 733 46.2 Plus