Clone LD36863 Report

Search the DGRC for LD36863

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:368
Well:63
Vector:pOT2
Associated Gene/Transcriptmetl-RB
Protein status:LD36863.pep: gold
Preliminary Size:1418
Sequenced Size:1236

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13929 2001-01-01 Release 2 assignment
CG13929 2001-07-04 Blastp of sequenced clone
CG13929 2003-01-01 Sim4 clustering to Release 3
metl 2008-04-29 Release 5.5 accounting
metl 2008-08-15 Release 5.9 accounting
metl 2008-12-18 5.12 accounting

Clone Sequence Records

LD36863.complete Sequence

1236 bp (1236 high quality bases) assembled on 2001-07-04

GenBank Submission: AY051875

> LD36863.complete
CACTGGCGGCGTGTTTACCAAAATATATAATTTGGATCGCACAAACAGGT
GATATATACCGTCATTCCTGTCCGATATGAGTGACAACCCCGCCGCGGAG
AACGAAAAGCGACCGCAGTTCGGAACCCGCCTGCTCACGGATGCTGACGA
CGTCTTCAAGCACAATGCTTGGTAAATATGGGTGGCAAATCCTCCGGAGA
TTGGCCAGCAAAAGTTGGGAACACACTCGCCAGCGTAAAAAACCGTCGGG
AGCGGGCAGCCGGGTGCTCACCGACGCGCGAGAGGTGTTCGAGTTTAACG
CCTGGGACCACGTGCAATGGGATGAAGAGCAGGAACTGGCCGCGAAGGCG
GCTGTAGCCAAGAATTCGACCTCAAAGATGGAAGCGGAGCAGAAGGAGCG
ATTTCAGACAGACGCCCCCAAGTTTTGGGATTCCTTCTACGGCATTCACG
ACAACCGCTTCTTCAAGGATCGCCACTGGCTGTTTACGGAGTTCCCCGAA
CTAGCTCCTCTGGCGGCGGATTCGGCGGTACTGCAACCACGTAGCATTTT
CGAACTGGGCTGTGGAGTAGGAAACACAATTTTACCCCTTCTACAGTACA
GCTCTGAACCGCAGCTCAAGGTTTTCGGATGTGACTTCTCCGCCCGGGCC
ATTGAAATCCTGCGAAGCCAACGGCAGTTCGACGAGAAGCGCTGCGAGGT
GTTTGTCATGGATGCCACGCTGGATCATTGGCAGGTGCCCTTCGAGGAAA
ACTCACAGGACATTATTGTGATGATTTTTGTGCTGTCCGCAATTGAGCCA
AAGAAAATGCAGCGGGTATTGGACAATTGCTATCGCTACCTGCGTCCCGG
TGGCTTGCTCCTCTTCCGCGACTACGGACGATACGACCTGGCACAGCTGC
GCTTCAAGAGCGGCAAGTGTATGGAGGACAACTTCTACGTGCGAGGCGAC
GGCACCATGGTGTACTTCTTCACGGAGGAAGAACTGCGGGGTATGATGAC
TCAAGCGGGGCTGCAGGAGGAGCAGCTCATTGTGGACCGAAGACTGCAAG
TTAATCGCTGTCGCGGCTTGAAAATGTACCGCGTGTGGATTCAGACAAAG
TTCAGGAAACCGCTTTAAATCAATTTAGACGAATAGTTCTGTGCATTTTA
AACCTTGTTCAAATCAATTGATATAATTATTTACACGATATATTTAAAAA
TACAAAGTTAAAACTTCAAAAAAAAAAAAAAAAAAA

LD36863.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:29:53
Subject Length Description Subject Range Query Range Score Percent Strand
metl-RB 1340 metl-RB 85..1304 1..1220 6100 100 Plus
metl-RA 1354 metl-RA 401..1318 303..1220 4590 100 Plus
metl-RA 1354 metl-RA 232..403 1..172 860 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:21:53
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 1637542..1638455 1217..304 4495 99.5 Minus
chr3L 24539361 chr3L 1638508..1638812 305..1 1435 98 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:31:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:21:51
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1637939..1638855 1220..304 4585 100 Minus
3L 28110227 3L 1638908..1639212 305..1 1525 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:52:11
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 1637939..1638855 1220..304 4585 100 Minus
3L 28103327 3L 1638908..1639212 305..1 1525 100 Minus
Blast to na_te.dros performed on 2019-03-16 01:21:51 has no hits.

LD36863.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:22:29 Download gff for LD36863.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 1637542..1638454 305..1217 99 <- Minus
chr3L 1638509..1638812 1..304 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:19:19 Download gff for LD36863.complete
Subject Subject Range Query Range Percent Splice Strand
metl-RB 1..978 141..1118 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:17:49 Download gff for LD36863.complete
Subject Subject Range Query Range Percent Splice Strand
metl-RB 1..978 141..1118 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:05:47 Download gff for LD36863.complete
Subject Subject Range Query Range Percent Splice Strand
metl-RB 1..978 141..1118 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:49:19 Download gff for LD36863.complete
Subject Subject Range Query Range Percent Splice Strand
metl-RB 1..978 141..1118 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:32:37 Download gff for LD36863.complete
Subject Subject Range Query Range Percent Splice Strand
metl-RB 1..978 141..1118 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:12:46 Download gff for LD36863.complete
Subject Subject Range Query Range Percent Splice Strand
metl-RB 20..1236 1..1217 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:17:49 Download gff for LD36863.complete
Subject Subject Range Query Range Percent Splice Strand
metl-RB 20..1236 1..1217 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:05:47 Download gff for LD36863.complete
Subject Subject Range Query Range Percent Splice Strand
metl-RB 24..1240 1..1217 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:49:19 Download gff for LD36863.complete
Subject Subject Range Query Range Percent Splice Strand
metl-RB 20..1236 1..1217 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:32:37 Download gff for LD36863.complete
Subject Subject Range Query Range Percent Splice Strand
metl-RB 24..1240 1..1217 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:22:29 Download gff for LD36863.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1637942..1638854 305..1217 100 <- Minus
3L 1638909..1639212 1..304 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:22:29 Download gff for LD36863.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1637942..1638854 305..1217 100 <- Minus
3L 1638909..1639212 1..304 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:22:29 Download gff for LD36863.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1637942..1638854 305..1217 100 <- Minus
3L 1638909..1639212 1..304 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:05:47 Download gff for LD36863.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1637942..1638854 305..1217 100 <- Minus
arm_3L 1638909..1639212 1..304 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:27:32 Download gff for LD36863.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1637942..1638854 305..1217 100 <- Minus
3L 1638909..1639212 1..304 100   Minus

LD36863.pep Sequence

Translation from 140 to 1117

> LD36863.pep
MLTTSSSTMLGKYGWQILRRLASKSWEHTRQRKKPSGAGSRVLTDAREVF
EFNAWDHVQWDEEQELAAKAAVAKNSTSKMEAEQKERFQTDAPKFWDSFY
GIHDNRFFKDRHWLFTEFPELAPLAADSAVLQPRSIFELGCGVGNTILPL
LQYSSEPQLKVFGCDFSARAIEILRSQRQFDEKRCEVFVMDATLDHWQVP
FEENSQDIIVMIFVLSAIEPKKMQRVLDNCYRYLRPGGLLLFRDYGRYDL
AQLRFKSGKCMEDNFYVRGDGTMVYFFTEEELRGMMTQAGLQEEQLIVDR
RLQVNRCRGLKMYRVWIQTKFRKPL*

LD36863.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:58:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24018-PA 319 GF24018-PA 1..319 9..325 1483 87.1 Plus
Dana\GF19776-PA 77 GF19776-PA 1..74 250..323 138 39.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:58:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14580-PA 302 GG14580-PA 7..302 29..325 1469 92.6 Plus
Dere\GG21815-PA 283 GG21815-PA 40..280 87..323 439 43 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:58:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15520-PA 338 GH15520-PA 21..338 7..325 1340 80.9 Plus
Dgri\GH21487-PA 263 GH21487-PA 16..258 87..323 494 41.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:37:32
Subject Length Description Subject Range Query Range Score Percent Strand
metl-PB 325 CG13929-PB 1..325 1..325 1720 100 Plus
metl-PA 302 CG13929-PA 8..302 31..325 1495 95.6 Plus
CG34195-PA 283 CG34195-PA 27..280 74..323 480 39.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:58:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16799-PA 342 GI16799-PA 22..339 7..325 1347 80.6 Plus
Dmoj\GI19964-PA 278 GI19964-PA 13..274 72..323 489 38.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:58:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20731-PA 337 GL20731-PA 17..333 7..325 1430 82.8 Plus
Dper\GL17216-PA 291 GL17216-PA 16..288 63..323 495 39.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:58:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12634-PA 337 GA12634-PA 17..333 7..325 1427 82.4 Plus
Dpse\GA25046-PA 291 GA25046-PA 16..288 63..323 495 39.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:58:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14194-PA 302 GM14194-PA 16..302 39..325 1475 94.4 Plus
Dsec\GM21817-PA 283 GM21817-PA 40..283 87..325 425 41.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:58:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17608-PA 302 GD17608-PA 16..302 39..325 1470 94.1 Plus
Dsim\GD11308-PA 283 GD11308-PA 40..280 87..323 437 41.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:58:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12543-PA 338 GJ12543-PA 22..338 8..325 1373 81.8 Plus
Dvir\GJ17971-PA 143 GJ17971-PA 3..139 187..323 281 43.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:58:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23661-PA 348 GK23661-PA 37..348 22..325 1330 77.9 Plus
Dwil\GK23259-PA 294 GK23259-PA 11..293 64..323 483 37 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:58:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20940-PA 302 GE20940-PA 16..302 39..325 1454 93.7 Plus
Dyak\GE11892-PA 283 GE11892-PA 40..280 87..323 430 41.4 Plus

LD36863.hyp Sequence

Translation from 140 to 1117

> LD36863.hyp
MLTTSSSTMLGKYGWQILRRLASKSWEHTRQRKKPSGAGSRVLTDAREVF
EFNAWDHVQWDEEQELAAKAAVAKNSTSKMEAEQKERFQTDAPKFWDSFY
GIHDNRFFKDRHWLFTEFPELAPLAADSAVLQPRSIFELGCGVGNTILPL
LQYSSEPQLKVFGCDFSARAIEILRSQRQFDEKRCEVFVMDATLDHWQVP
FEENSQDIIVMIFVLSAIEPKKMQRVLDNCYRYLRPGGLLLFRDYGRYDL
AQLRFKSGKCMEDNFYVRGDGTMVYFFTEEELRGMMTQAGLQEEQLIVDR
RLQVNRCRGLKMYRVWIQTKFRKPL*

LD36863.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:05:06
Subject Length Description Subject Range Query Range Score Percent Strand
metl-PB 325 CG13929-PB 1..325 1..325 1720 100 Plus
metl-PA 302 CG13929-PA 8..302 31..325 1495 95.6 Plus
CG34195-PA 283 CG34195-PA 27..280 74..323 480 39.7 Plus