Clone LD37169 Report

Search the DGRC for LD37169

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:371
Well:69
Vector:pOT2
Associated Gene/TranscriptCG14207-RA
Protein status:LD37169.pep: gold
Preliminary Size:1258
Sequenced Size:1195

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14207 2001-01-01 Release 2 assignment
CG14207 2003-01-01 Sim4 clustering to Release 3
CG14207 2003-01-13 Blastp of sequenced clone
CG14207 2008-04-29 Release 5.5 accounting
CG14207 2008-08-15 Release 5.9 accounting
CG14207 2008-12-18 5.12 accounting

Clone Sequence Records

LD37169.complete Sequence

1195 bp (1195 high quality bases) assembled on 2003-01-13

GenBank Submission: AY061439

> LD37169.complete
CAAAGACACACTGTGAATGCAAAACAGTTCAGAAATTGAAACGCGGCTAT
CTGTGCGATACGTCCAACCGAAATCACACACTTGAACGTCTTGAGTTTCG
AATACATATAGAAAACCCATCGAGTTCCCTTTTTTTTTGGTTGCTCCGTC
GATTAGCAAGTGAACAAGCTCGAAAGCGCGTTGAGCAGAACAGAACAGAA
CAGAGAATAATAGAACGGTATACAGTATATACAGTATATACGGTATACAG
TGTACAGCGAAGAGATTGGAGATTCCATCTAGCGAAGCAACCACCAAATA
AACCACCACAAACAGCACAACAATGGCCGAGGCTAACAAGAGGAATATCC
CCATCAAGCTGGGCGACTTCAGCGTCATCGACACGGAGTTCAGCAACATC
CGCGAGCGCTTCGACTCCGAGATGCGCAAAATGGAGGAGGAGATGGCCAA
GTTCCGTCACGAGCTGATGAACCGCGAGGCGAACTTCTTCGAGTCCACCA
GCTCAACGACAAACTCGGCGCTGCCATCCCGAATCCCAAAGCAACAGAAC
TACGTCTCCGACATTAGCTCACCCTTGATCCAGGATGAGGGCGATAACAA
AGTGCTGAAGCTGCGTTTCGATGTCAGCCAGTATGCGCCCGAGGAAATTG
TTGTGAAAACCGTCGACCAGAAGCTATTGGTGCACGCCAAGCACGAGGAG
AAGTCGGACACAAAGAGCGTGTACAGGGAGTACAATCGGGAGTTCCTGCT
GCCCAAGGGCGTCAATCCCGAGTCCATCCGCTCGTCCCTCAGCAAGGACG
GAGTCCTGACCGTGGACGCCCCCCTGCCAGCACTCACCGCCGGCGAGACA
CTGATTCCCATTGCGCACAAGTGAAGGCCAGCCCAGTTGTCCAGTTGTCC
AGCTATCCAGTCACCATGGTCCCAAGCCGGTTGAGGAGCAATAGGCGCAG
GAGGAGCAGGAGGAGTGCGAGCTGCTGCCGATCAGATTAAATCCATACAC
ACATTGAGTTTAATCCAATCCTATCTAAATGATTAATTTTTTTGGTTCTG
ACTTAAAGCTAAACTATGTTACTGACGTACTACTCATTAACTTAAATATA
ATTGAAATTATTATTAAATTTGATTAATTTAATTCATATTTATAATTTTC
GCATTAAACGTAATCAATTTTGCCGTAAAAAAAAAAAAAAAAAAA

LD37169.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:27:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG14207-RA 1504 CG14207-RA 76..1252 1..1177 5885 100 Plus
CG14207.a 1025 CG14207.a 155..838 494..1177 3420 100 Plus
CG14207-RB 1480 CG14207-RB 548..1228 497..1177 3405 100 Plus
CG14207-RB 1480 CG14207-RB 25..528 1..504 2520 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:38:08
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 19494005..19494505 1..501 2505 100 Plus
chrX 22417052 chrX 19499487..19499984 679..1176 2475 99.8 Plus
chrX 22417052 chrX 19499317..19499417 581..681 505 100 Plus
chrX 22417052 chrX 19499170..19499255 499..584 430 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:31:53 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:38:06
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19605182..19605682 1..501 2505 100 Plus
X 23542271 X 19610695..19611193 679..1177 2495 100 Plus
X 23542271 X 19610525..19610625 581..681 505 100 Plus
X 23542271 X 19610378..19610463 499..584 430 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:04:17
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 19613280..19613780 1..501 2505 100 Plus
X 23527363 X 19618793..19619291 679..1177 2495 100 Plus
X 23527363 X 19618623..19618723 581..681 505 100 Plus
X 23527363 X 19618476..19618561 499..584 430 100 Plus
Blast to na_te.dros performed on 2019-03-16 20:38:07 has no hits.

LD37169.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:38:50 Download gff for LD37169.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 19494005..19494505 1..501 92 -> Plus
chrX 19499173..19499254 502..583 100 -> Plus
chrX 19499320..19499415 584..679 100 -> Plus
chrX 19499488..19499899 680..1091 100 == Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:19:32 Download gff for LD37169.complete
Subject Subject Range Query Range Percent Splice Strand
CG14207-RA 1..552 323..874 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:58:06 Download gff for LD37169.complete
Subject Subject Range Query Range Percent Splice Strand
HspB8-RA 1..552 323..874 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:25:17 Download gff for LD37169.complete
Subject Subject Range Query Range Percent Splice Strand
CG14207-RA 1..552 323..874 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:48:54 Download gff for LD37169.complete
Subject Subject Range Query Range Percent Splice Strand
CG14207-RA 1..552 323..874 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:08:43 Download gff for LD37169.complete
Subject Subject Range Query Range Percent Splice Strand
CG14207-RA 1..552 323..874 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:14:33 Download gff for LD37169.complete
Subject Subject Range Query Range Percent Splice Strand
CG14207-RA 25..1200 1..1176 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:58:06 Download gff for LD37169.complete
Subject Subject Range Query Range Percent Splice Strand
HspB8-RA 25..1200 1..1176 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:25:17 Download gff for LD37169.complete
Subject Subject Range Query Range Percent Splice Strand
CG14207-RA 1..1159 18..1176 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:48:55 Download gff for LD37169.complete
Subject Subject Range Query Range Percent Splice Strand
CG14207-RA 25..1200 1..1176 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:08:43 Download gff for LD37169.complete
Subject Subject Range Query Range Percent Splice Strand
CG14207-RA 1..1159 18..1176 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:38:50 Download gff for LD37169.complete
Subject Subject Range Query Range Percent Splice Strand
X 19605182..19605682 1..501 100 -> Plus
X 19610381..19610462 502..583 100 -> Plus
X 19610528..19610623 584..679 100 -> Plus
X 19610696..19611192 680..1176 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:38:50 Download gff for LD37169.complete
Subject Subject Range Query Range Percent Splice Strand
X 19605182..19605682 1..501 100 -> Plus
X 19610381..19610462 502..583 100 -> Plus
X 19610528..19610623 584..679 100 -> Plus
X 19610696..19611192 680..1176 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:38:50 Download gff for LD37169.complete
Subject Subject Range Query Range Percent Splice Strand
X 19605182..19605682 1..501 100 -> Plus
X 19610381..19610462 502..583 100 -> Plus
X 19610528..19610623 584..679 100 -> Plus
X 19610696..19611192 680..1176 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:25:17 Download gff for LD37169.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 19499215..19499715 1..501 100 -> Plus
arm_X 19504414..19504495 502..583 100 -> Plus
arm_X 19504561..19504656 584..679 100 -> Plus
arm_X 19504729..19505225 680..1176 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:20:20 Download gff for LD37169.complete
Subject Subject Range Query Range Percent Splice Strand
X 19613280..19613780 1..501 100 -> Plus
X 19618479..19618560 502..583 100 -> Plus
X 19618626..19618721 584..679 100 -> Plus
X 19618794..19619290 680..1176 100   Plus

LD37169.pep Sequence

Translation from 322 to 873

> LD37169.pep
MAEANKRNIPIKLGDFSVIDTEFSNIRERFDSEMRKMEEEMAKFRHELMN
REANFFESTSSTTNSALPSRIPKQQNYVSDISSPLIQDEGDNKVLKLRFD
VSQYAPEEIVVKTVDQKLLVHAKHEEKSDTKSVYREYNREFLLPKGVNPE
SIRSSLSKDGVLTVDAPLPALTAGETLIPIAHK*

LD37169.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:10:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20408-PA 193 GF20408-PA 1..193 1..183 945 94.8 Plus
Dana\GF11829-PA 187 GF11829-PA 75..156 91..171 190 45.1 Plus
Dana\GF23739-PA 205 GF23739-PA 65..161 73..169 163 35.7 Plus
Dana\GF10691-PA 190 GF10691-PA 71..146 95..169 160 42.1 Plus
Dana\GF10323-PA 155 GF10323-PA 48..136 80..172 153 39.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:10:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19234-PA 192 GG19234-PA 1..192 1..183 945 95.3 Plus
Dere\GG20009-PA 187 GG20009-PA 75..161 91..176 192 43.7 Plus
Dere\GG14046-PA 445 GG14046-PA 126..201 95..169 176 42.1 Plus
Dere\GG14047-PA 208 GG14047-PA 74..164 79..169 159 39.1 Plus
Dere\GG14448-PA 154 GG14448-PA 47..140 80..177 151 38.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:10:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24938-PA 193 GH24938-PA 1..193 1..183 933 93.3 Plus
Dgri\GH21555-PA 189 GH21555-PA 77..171 91..182 183 41.1 Plus
Dgri\GH14699-PA 605 GH14699-PA 204..274 95..164 170 42.3 Plus
Dgri\GH14558-PA 201 GH14558-PA 93..178 89..172 163 38.4 Plus
Dgri\GH23707-PA 185 GH23707-PA 72..148 95..170 162 42.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:47:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG14207-PD 183 CG14207-PD 1..183 1..183 922 100 Plus
CG14207-PA 183 CG14207-PA 1..183 1..183 922 100 Plus
CG14207-PB 192 CG14207-PB 1..192 1..183 902 95.3 Plus
CG14207-PC 154 CG14207-PC 29..154 58..183 631 100 Plus
l(2)efl-PC 187 CG4533-PC 75..161 91..176 194 43.7 Plus
l(2)efl-PA 187 CG4533-PA 75..161 91..176 194 43.7 Plus
Hsp27-PB 213 CG4466-PB 95..165 100..169 169 46.5 Plus
Hsp27-PA 213 CG4466-PA 95..165 100..169 169 46.5 Plus
Hsp67Ba-PA 445 CG4167-PA 128..202 96..169 169 42.7 Plus
CG4461-PA 200 CG4461-PA 94..189 91..180 161 36.5 Plus
Hsp26-PB 208 CG4183-PB 94..164 100..169 156 45.1 Plus
Hsp26-PA 208 CG4183-PA 94..164 100..169 156 45.1 Plus
Hsp23-PB 186 CG4463-PB 76..146 100..169 151 42.3 Plus
Hsp23-PA 186 CG4463-PA 76..146 100..169 151 42.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:10:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11114-PA 193 GI11114-PA 1..193 1..183 930 93.3 Plus
Dmoj\GI19527-PA 189 GI19527-PA 77..158 91..171 188 45.1 Plus
Dmoj\GI12246-PA 558 GI12246-PA 164..236 95..166 167 41.1 Plus
Dmoj\GI12245-PA 198 GI12245-PA 73..185 80..178 166 35.4 Plus
Dmoj\GI13089-PA 193 GI13089-PA 81..170 96..182 166 40 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:10:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27055-PA 193 GL27055-PA 1..193 1..183 945 94.8 Plus
Dper\GL17594-PA 202 GL17594-PA 75..156 91..171 188 45.1 Plus
Dper\GL22632-PA 204 GL22632-PA 71..166 79..183 169 37 Plus
Dper\GL18037-PA 163 GL18037-PA 56..144 80..172 157 39.4 Plus
Dper\GL22446-PA 184 GL22446-PA 71..146 95..169 154 40.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:10:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12823-PA 193 GA12823-PA 1..193 1..183 945 94.8 Plus
Dpse\GA18238-PA 187 GA18238-PA 75..156 91..171 189 45.1 Plus
Dpse\GA18011-PA 204 GA18011-PA 71..166 79..183 169 37 Plus
Dpse\GA20330-PA 154 GA20330-PA 47..135 80..172 157 39.4 Plus
Dpse\GA18202-PA 184 GA18202-PA 71..146 95..169 153 40.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:10:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22970-PA 192 GM22970-PA 1..192 1..183 945 95.3 Plus
Dsec\GM15521-PA 187 GM15521-PA 75..161 91..176 192 43.7 Plus
Dsec\GM24880-PA 403 GM24880-PA 127..202 95..169 173 40.8 Plus
Dsec\GM24881-PA 211 GM24881-PA 74..164 79..169 159 39.1 Plus
Dsec\GM25000-PA 154 GM25000-PA 47..135 80..172 149 39.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:10:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24875-PA 115 GD24875-PA 1..115 69..183 594 99.1 Plus
Dsim\GD17451-PA 98 GD17451-PA 1..62 1..62 325 100 Plus
Dsim\GD25025-PA 187 GD25025-PA 75..161 91..176 192 43.7 Plus
Dsim\GD12932-PA 391 GD12932-PA 73..148 95..169 173 40.8 Plus
Dsim\GD12933-PA 211 GD12933-PA 74..164 79..169 159 39.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:10:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15970-PA 193 GJ15970-PA 1..193 1..183 934 93.3 Plus
Dvir\GJ21096-PA 189 GJ21096-PA 77..171 91..182 195 44.2 Plus
Dvir\GJ11478-PA 532 GJ11478-PA 173..243 95..164 173 42.3 Plus
Dvir\GJ11477-PA 199 GJ11477-PA 91..186 89..178 167 36.5 Plus
Dvir\GJ13836-PA 214 GJ13836-PA 91..166 95..169 166 43.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:10:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25198-PA 194 GK25198-PA 1..194 1..183 887 92.3 Plus
Dwil\GK23172-PA 187 GK23172-PA 75..156 91..171 187 43.9 Plus
Dwil\GK16565-PA 471 GK16565-PA 141..213 95..166 161 41.1 Plus
Dwil\GK17636-PA 186 GK17636-PA 70..145 95..169 151 39.5 Plus
Dwil\GK21206-PA 155 GK21206-PA 48..132 80..167 148 38.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:10:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15853-PA 192 GE15853-PA 1..192 1..183 945 95.3 Plus
Dyak\GE11545-PA 187 GE11545-PA 75..161 91..176 192 43.7 Plus
Dyak\GE21250-PA 208 GE21250-PA 74..164 79..169 160 39.1 Plus
Dyak\GE21249-PA 448 GE21249-PA 126..195 95..163 158 40 Plus
Dyak\GE21638-PA 154 GE21638-PA 47..135 80..172 152 39.4 Plus

LD37169.hyp Sequence

Translation from 322 to 873

> LD37169.hyp
MAEANKRNIPIKLGDFSVIDTEFSNIRERFDSEMRKMEEEMAKFRHELMN
REANFFESTSSTTNSALPSRIPKQQNYVSDISSPLIQDEGDNKVLKLRFD
VSQYAPEEIVVKTVDQKLLVHAKHEEKSDTKSVYREYNREFLLPKGVNPE
SIRSSLSKDGVLTVDAPLPALTAGETLIPIAHK*

LD37169.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:31:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG14207-PD 183 CG14207-PD 1..183 1..183 922 100 Plus
CG14207-PA 183 CG14207-PA 1..183 1..183 922 100 Plus
CG14207-PB 192 CG14207-PB 1..192 1..183 902 95.3 Plus
CG14207-PC 154 CG14207-PC 29..154 58..183 631 100 Plus
l(2)efl-PC 187 CG4533-PC 75..161 91..176 194 43.7 Plus