BDGP Sequence Production Resources |
Search the DGRC for LD37196
Library: | LD |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Ling Hong |
Date Registered: | 1997-12-04 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 371 |
Well: | 96 |
Vector: | pOT2 |
Associated Gene/Transcript | Spc25-RA |
Protein status: | LD37196.pep: gold |
Preliminary Size: | 1075 |
Sequenced Size: | 966 |
Gene | Date | Evidence |
---|---|---|
CG7242 | 2001-01-01 | Release 2 assignment |
CG7242 | 2003-01-01 | Sim4 clustering to Release 3 |
CG7242 | 2003-01-15 | Blastp of sequenced clone |
Spc25 | 2008-04-29 | Release 5.5 accounting |
Spc25 | 2008-08-15 | Release 5.9 accounting |
Spc25 | 2008-12-18 | 5.12 accounting |
966 bp (966 high quality bases) assembled on 2003-01-15
GenBank Submission: AY051881
> LD37196.complete CAAAACAAGCGTCTGGAAAACGGCGCTTAGTTTTTAAAGATTTTAATTGA TTGCAGTAAATTGAGTTTAAAATGGCAATTATTATGACTGAATCGAGTTA CGAAAGGCGCGTAAAGGCTTTGTACGAAAAACAAATTCACATGGAAGCCC TCGAGGCGAAATTCATCAAAAAGGTCTTTAAATTCAACAGCAATTTGTTG GATGTCAAGGAAGCAGCTTCGCGCCATCAGCGGAAAGTGGGAAAGTTGCA AAAAGTGCTCATGGAGCGGCGGGAGGAGTTGGACAAGCGAGTTTCCTTCA TAGAGGAACTTGATCGAGAACTGGAGGCCACCAAACTTCACAATTTGGCC ATGAAAGATTGGTTTAAACAGCAGAAAATGCTGGCCAAACAGCGCAAAAA CGAAATCATGGAAAGCATTCACACGCTGTCGAAGACAACAAGAACCTATA TAAATCAAGAAGCGCTGCCGGCACGTGTGAAGGGTGTCACTGTACTCCGT GGCGATAAACGCGACCAGTTGATACCCTTTGATCTGAAGGCGACCGATGT GGAAGGACTGGACTCACTGTGTCAGCATCTCGAGAGTCTAAATGTGGACG TGGCGCAGTGGCAGCAGCTTATCTCGCTGGCCATGGACATGGCTATGGAG TCACGTGCTCCCACTACTCCGCCCAAGGAAGCAGACAATTGCAAGTCTAT AATCGAGATTGATCTCACATCGCCGATGAGCCACACCTGACTTCCGATTA ACTGATTTACTTGGATTAGGGGGAAGACCCTTTTCCAATGGAGCACTTTA TTTTAGCATTATAAATAGTTGGCTTCCAATAAAAGCTCAATTGGGAATTC ATCTTAACGAATTAAGCATCTTATTATAGCAGTTTTTTAGCCATTTAAGT ACTGCTTGTAATTGTTTAAGTGCAGTGTAAATTATACATATATCTCCCAA AAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Spc25-RA | 1185 | Spc25-RA | 48..999 | 1..952 | 4760 | 100 | Plus |
Spc25.b | 1195 | Spc25.b | 48..999 | 1..952 | 4760 | 100 | Plus |
Spc25.a | 977 | Spc25.a | 439..977 | 414..952 | 2695 | 100 | Plus |
Spc25.a | 977 | Spc25.a | 14..428 | 1..415 | 2075 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 8787953..8788487 | 414..948 | 2630 | 99.4 | Plus |
chr3R | 27901430 | chr3R | 8787248..8787464 | 199..415 | 1070 | 99.5 | Plus |
chr3R | 27901430 | chr3R | 8786987..8787184 | 1..198 | 945 | 98.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 12962715..12963253 | 414..952 | 2695 | 100 | Plus |
3R | 32079331 | 3R | 12962026..12962242 | 199..415 | 1085 | 100 | Plus |
3R | 32079331 | 3R | 12961765..12961962 | 1..198 | 990 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 12703546..12704084 | 414..952 | 2695 | 100 | Plus |
3R | 31820162 | 3R | 12702857..12703073 | 199..415 | 1085 | 100 | Plus |
3R | 31820162 | 3R | 12702596..12702793 | 1..198 | 990 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 8787248..8787464 | 199..415 | 99 | -> | Plus |
chr3R | 8786987..8787184 | 1..198 | 98 | -> | Plus |
chr3R | 8787955..8788487 | 416..948 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Spc25-RA | 1..669 | 72..740 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Spc25-RA | 1..669 | 72..740 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Spc25-RA | 1..669 | 72..740 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Spc25-RA | 1..669 | 72..740 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Spc25-RA | 1..669 | 72..740 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Spc25-RA | 14..961 | 1..948 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Spc25-RA | 14..961 | 1..948 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Spc25-RA | 21..968 | 1..948 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Spc25-RA | 14..961 | 1..948 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Spc25-RA | 21..968 | 1..948 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 12961765..12961962 | 1..198 | 100 | -> | Plus |
3R | 12962026..12962242 | 199..415 | 100 | -> | Plus |
3R | 12962717..12963249 | 416..948 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 12961765..12961962 | 1..198 | 100 | -> | Plus |
3R | 12962026..12962242 | 199..415 | 100 | -> | Plus |
3R | 12962717..12963249 | 416..948 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 12961765..12961962 | 1..198 | 100 | -> | Plus |
3R | 12962026..12962242 | 199..415 | 100 | -> | Plus |
3R | 12962717..12963249 | 416..948 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 8787748..8787964 | 199..415 | 100 | -> | Plus |
arm_3R | 8787487..8787684 | 1..198 | 100 | -> | Plus |
arm_3R | 8788439..8788971 | 416..948 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 12702857..12703073 | 199..415 | 100 | -> | Plus |
3R | 12703548..12704080 | 416..948 | 100 | Plus | |
3R | 12702596..12702793 | 1..198 | 100 | -> | Plus |
Translation from 71 to 739
> LD37196.pep MAIIMTESSYERRVKALYEKQIHMEALEAKFIKKVFKFNSNLLDVKEAAS RHQRKVGKLQKVLMERREELDKRVSFIEELDRELEATKLHNLAMKDWFKQ QKMLAKQRKNEIMESIHTLSKTTRTYINQEALPARVKGVTVLRGDKRDQL IPFDLKATDVEGLDSLCQHLESLNVDVAQWQQLISLAMDMAMESRAPTTP PKEADNCKSIIEIDLTSPMSHT*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF16921-PA | 215 | GF16921-PA | 11..212 | 8..221 | 460 | 47 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\mitch-PA | 220 | GG19269-PA | 1..220 | 1..220 | 977 | 83.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18360-PA | 209 | GH18360-PA | 9..208 | 12..221 | 250 | 34.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Spc25-PA | 222 | CG7242-PA | 1..222 | 1..222 | 1116 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23349-PA | 208 | GI23349-PA | 3..199 | 12..221 | 276 | 36.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24369-PA | 236 | GL24369-PA | 12..231 | 8..218 | 381 | 38.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA20206-PB | 235 | GA20206-PB | 12..230 | 8..218 | 384 | 38.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\mitch-PA | 222 | GM24067-PA | 1..221 | 1..221 | 1062 | 91.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\mitch-PA | 222 | GD18864-PA | 1..221 | 1..221 | 1068 | 91.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ10343-PA | 210 | GJ10343-PA | 9..209 | 12..221 | 249 | 32.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\mitch-PA | 223 | GE26225-PA | 1..221 | 1..221 | 1023 | 86.9 | Plus |
Translation from 71 to 739
> LD37196.hyp MAIIMTESSYERRVKALYEKQIHMEALEAKFIKKVFKFNSNLLDVKEAAS RHQRKVGKLQKVLMERREELDKRVSFIEELDRELEATKLHNLAMKDWFKQ QKMLAKQRKNEIMESIHTLSKTTRTYINQEALPARVKGVTVLRGDKRDQL IPFDLKATDVEGLDSLCQHLESLNVDVAQWQQLISLAMDMAMESRAPTTP PKEADNCKSIIEIDLTSPMSHT*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Spc25-PA | 222 | CG7242-PA | 1..222 | 1..222 | 1116 | 100 | Plus |