Clone LD37258 Report

Search the DGRC for LD37258

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:372
Well:58
Vector:pOT2
Associated Gene/TranscriptCG13601-RA
Protein status:LD37258.pep: gold
Preliminary Size:1234
Sequenced Size:1114

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13601 2001-01-01 Release 2 assignment
CG13601 2003-01-01 Sim4 clustering to Release 3
CG13601 2003-01-16 Blastp of sequenced clone
CG13601 2008-04-29 Release 5.5 accounting
CG13601 2008-08-15 Release 5.9 accounting
CG13601 2008-12-18 5.12 accounting

Clone Sequence Records

LD37258.complete Sequence

1114 bp (1114 high quality bases) assembled on 2003-01-16

GenBank Submission: AY118558

> LD37258.complete
TGAATATTTTGTAATAGTTATTAGTAAAAAATTAGTAAAGTAAAACAATG
GTTATTGGCGTCTTCCCGGCGGCCAAGCTCGGCATTTTGGCCATCAAGCA
GGTCAGCAAGCCGATAGCCAACGTGATTAAGTCCAATGCCAAATCGAGCC
CCTTCTTCAGGAAGTACATATGCATGCCGCCCGCACAGTTCTACAACTGG
GTAGAGGTGAAGACCAAGATGTGGGCCCTGAACATGGGTGGTCGCGTTAA
TGTTCCACCGCTGAACGAGGCGATGGCCATTGAGCTGGGAGCCAATCTGC
TTGGCGAGTTCATCATCTTCTCGATCGGAGCCGGTCTTTTGATTTTCGAG
TACTCACGTCAAACCATCAAGGAGAACAAGAAAAACGAGTTGGCGCAATC
GGAGAAGATGGAACTAACCAATATGCTGACGGAGATGAACTTTCGGCTGG
AGCGACAGGATGCCCAGATACGAGAAATGACGCGAGTGCTGGCTGATCTA
GATTCGCGAAACATTTTCCGGTGGCACAAGGAGCCGATTCAGGAATACGT
GCCCTTCGATCCCGACACGCCGGACCAGAGTGCCAGCGCCAGGAATCCGA
AAAAGTTCGACAGCTTATATGACCCGCAAGGCGGTATGGCCTTCCGCGCC
CTGCACTTCCTGGACACGCAGATCTTCGTGGACGGACGCAACCGCAAGGC
CAAGGAGGCTCTCCAGCACCTGGATGAGGTGGCCGTGCAGCTGGAGCAGT
CTCTGGGAGAGGCAGCCACCGTTGCCGTTGCCAGCTCACTGCCTACAAAA
GCAGCCGACCTTTGACCAAAGCGGCAGCTAGAGCAGGATCTGGCCCTGCT
CATGATGGCAGTGGCGATGGAGGAACAGTAAGGCCGCCCGCTTGTACACA
TTCAACCTGCAGACCATTTCATCAGTGCTAGTTATGATCAAATCGCGTGT
TACCATTTCGTACTTTAAGTATAAAAGTCAATAGTATTCTATAACTATTG
GACGTTTGTAGTTATATTTATTAATTTTTATTGTTACCGCAGACAAACAA
CTAAAGAGATGCAAAACAGTGTAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAA

LD37258.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:25:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG13601-RA 1151 CG13601-RA 57..1129 1..1073 5365 100 Plus
CG5857-RA 2042 CG5857-RA 1967..2042 1073..998 380 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:57:36
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 19749818..19750390 1072..500 2850 99.8 Minus
chr3R 27901430 chr3R 19750873..19751061 189..2 880 98.9 Minus
chr3R 27901430 chr3R 19750649..19750817 358..190 845 100 Minus
chr3R 27901430 chr3R 19750444..19750591 505..358 725 99.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:32:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:57:34
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23926371..23926944 1073..500 2870 100 Minus
3R 32079331 3R 23927427..23927615 189..1 945 100 Minus
3R 32079331 3R 23927203..23927371 358..190 845 100 Minus
3R 32079331 3R 23926998..23927145 505..358 725 99.3 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:02:44
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 23667202..23667775 1073..500 2870 100 Minus
3R 31820162 3R 23668258..23668446 189..1 945 100 Minus
3R 31820162 3R 23668034..23668202 358..190 845 100 Minus
3R 31820162 3R 23667829..23667976 505..358 725 99.3 Minus
Blast to na_te.dros performed on 2019-03-16 11:57:35 has no hits.

LD37258.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:58:48 Download gff for LD37258.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 19750649..19750817 190..358 100 <- Minus
chr3R 19750873..19751061 1..189 98   Minus
chr3R 19749818..19750388 502..1072 99 <- Minus
chr3R 19750448..19750590 359..501 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:19:42 Download gff for LD37258.complete
Subject Subject Range Query Range Percent Splice Strand
CG13601-RA 1..768 48..815 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:55:43 Download gff for LD37258.complete
Subject Subject Range Query Range Percent Splice Strand
CG13601-RA 1..768 48..815 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:42:47 Download gff for LD37258.complete
Subject Subject Range Query Range Percent Splice Strand
CG13601-RB 1..834 48..881 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:46:43 Download gff for LD37258.complete
Subject Subject Range Query Range Percent Splice Strand
CG13601-RA 1..768 48..815 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:31:29 Download gff for LD37258.complete
Subject Subject Range Query Range Percent Splice Strand
CG13601-RB 1..834 48..881 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:11:10 Download gff for LD37258.complete
Subject Subject Range Query Range Percent Splice Strand
CG13601-RA 18..1089 1..1072 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:55:43 Download gff for LD37258.complete
Subject Subject Range Query Range Percent Splice Strand
CG13601-RA 18..1089 1..1072 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:42:47 Download gff for LD37258.complete
Subject Subject Range Query Range Percent Splice Strand
CG13601-RA 20..1091 1..1072 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:46:43 Download gff for LD37258.complete
Subject Subject Range Query Range Percent Splice Strand
CG13601-RA 18..1089 1..1072 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:31:29 Download gff for LD37258.complete
Subject Subject Range Query Range Percent Splice Strand
CG13601-RA 20..1091 1..1072 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:58:48 Download gff for LD37258.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23926372..23926942 502..1072 100 <- Minus
3R 23927002..23927144 359..501 100 <- Minus
3R 23927203..23927371 190..358 100 <- Minus
3R 23927427..23927615 1..189 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:58:48 Download gff for LD37258.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23926372..23926942 502..1072 100 <- Minus
3R 23927002..23927144 359..501 100 <- Minus
3R 23927203..23927371 190..358 100 <- Minus
3R 23927427..23927615 1..189 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:58:48 Download gff for LD37258.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23926372..23926942 502..1072 100 <- Minus
3R 23927002..23927144 359..501 100 <- Minus
3R 23927203..23927371 190..358 100 <- Minus
3R 23927427..23927615 1..189 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:42:47 Download gff for LD37258.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19752094..19752664 502..1072 100 <- Minus
arm_3R 19752724..19752866 359..501 100 <- Minus
arm_3R 19752925..19753093 190..358 100 <- Minus
arm_3R 19753149..19753337 1..189 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:17:51 Download gff for LD37258.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23667203..23667773 502..1072 100 <- Minus
3R 23667833..23667975 359..501 100 <- Minus
3R 23668034..23668202 190..358 100 <- Minus
3R 23668258..23668446 1..189 100   Minus

LD37258.pep Sequence

Translation from 47 to 814

> LD37258.pep
MVIGVFPAAKLGILAIKQVSKPIANVIKSNAKSSPFFRKYICMPPAQFYN
WVEVKTKMWALNMGGRVNVPPLNEAMAIELGANLLGEFIIFSIGAGLLIF
EYSRQTIKENKKNELAQSEKMELTNMLTEMNFRLERQDAQIREMTRVLAD
LDSRNIFRWHKEPIQEYVPFDPDTPDQSASARNPKKFDSLYDPQGGMAFR
ALHFLDTQIFVDGRNRKAKEALQHLDEVAVQLEQSLGEAATVAVASSLPT
KAADL*

LD37258.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:57:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17980-PA 253 GF17980-PA 1..250 1..251 1192 89.7 Plus
Dana\GF17024-PA 148 GF17024-PA 1..144 1..144 344 43.8 Plus
Dana\GF19900-PA 104 GF19900-PA 1..104 1..104 215 37.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:57:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12393-PA 255 GG12393-PA 1..255 1..255 1330 97.3 Plus
Dere\GG12391-PA 166 GG12391-PA 1..153 1..153 322 38.6 Plus
Dere\GG12392-PA 111 GG12392-PA 1..109 1..109 230 41.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:57:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17511-PA 255 GH17511-PA 1..239 1..239 1100 83.7 Plus
Dgri\GH17510-PA 104 GH17510-PA 1..104 1..104 201 39.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:02:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG13601-PB 277 CG13601-PB 1..255 1..255 1300 100 Plus
CG13601-PA 255 CG13601-PA 1..255 1..255 1300 100 Plus
CG43999-PC 166 CR43999-PC 1..153 1..153 315 38.6 Plus
CG43999-PB 166 CR43999-PB 1..153 1..153 315 38.6 Plus
CG43998-PD 153 CG43998-PD 1..152 1..152 264 35.5 Plus
CG43998-PC 153 CG43998-PC 1..152 1..152 264 35.5 Plus
CG43998-PB 153 CG43998-PB 1..152 1..152 264 35.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:57:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10378-PA 251 GI10378-PA 1..249 1..252 1117 82.1 Plus
Dmoj\GI16934-PA 155 GI16934-PA 1..140 2..141 252 37.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:57:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23345-PA 131 GL23345-PA 1..114 1..113 549 90.4 Plus
Dper\GL23344-PA 104 GL23344-PA 1..104 1..104 261 49 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:57:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12394-PA 254 GA12394-PA 1..251 1..251 1139 84.9 Plus
Dpse\GA12395-PB 252 GA12395-PB 1..141 1..141 356 46.1 Plus
Dpse\GA12395-PB 252 GA12395-PB 149..252 1..104 259 48.1 Plus
Dpse\GA12395-PA 104 GA12395-PA 1..104 1..104 258 48.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:57:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23530-PA 253 GM23530-PA 1..253 1..255 1310 97.3 Plus
Dsec\GM23528-PA 170 GM23528-PA 1..153 1..153 330 39.2 Plus
Dsec\GM23529-PA 111 GM23529-PA 1..104 1..104 238 43.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:57:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18341-PA 255 GD18341-PA 1..255 1..255 1346 98.8 Plus
Dsim\GD18340-PA 111 GD18340-PA 1..104 1..104 238 43.3 Plus
Dsim\GD18338-PA 67 GD18338-PA 1..57 1..57 164 49.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:57:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22840-PA 251 GJ22840-PA 1..243 1..243 1115 83.5 Plus
Dvir\GJ22839-PA 103 GJ22839-PA 1..103 2..104 223 41.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:57:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22621-PA 253 GK22621-PA 1..250 1..251 1065 77.7 Plus
Dwil\GK22620-PA 104 GK22620-PA 1..104 1..104 303 51.9 Plus
Dwil\GK19115-PA 108 GK19115-PA 10..108 6..104 293 51.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:57:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23911-PA 255 GE23911-PA 1..255 1..255 1322 96.9 Plus
Dyak\GE23909-PA 166 GE23909-PA 1..144 1..144 332 41.7 Plus
Dyak\GE23910-PA 153 GE23910-PA 1..152 1..152 260 34.9 Plus

LD37258.hyp Sequence

Translation from 47 to 814

> LD37258.hyp
MVIGVFPAAKLGILAIKQVSKPIANVIKSNAKSSPFFRKYICMPPAQFYN
WVEVKTKMWALNMGGRVNVPPLNEAMAIELGANLLGEFIIFSIGAGLLIF
EYSRQTIKENKKNELAQSEKMELTNMLTEMNFRLERQDAQIREMTRVLAD
LDSRNIFRWHKEPIQEYVPFDPDTPDQSASARNPKKFDSLYDPQGGMAFR
ALHFLDTQIFVDGRNRKAKEALQHLDEVAVQLEQSLGEAATVAVASSLPT
KAADL*

LD37258.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:39:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG13601-PA 255 CG13601-PA 1..255 1..255 1300 100 Plus
CG13601-PB 277 CG13601-PB 1..255 1..255 1300 100 Plus
CG43999-PC 166 CR43999-PC 1..153 1..153 315 38.6 Plus
CG43999-PB 166 CR43999-PB 1..153 1..153 315 38.6 Plus
CG43998-PD 153 CG43998-PD 1..152 1..152 264 35.5 Plus