Clone LD37470 Report

Search the DGRC for LD37470

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:374
Well:70
Vector:pOT2
Associated Gene/Transcripttwf-RA
Protein status:LD37470.pep: gold
Preliminary Size:1480
Sequenced Size:1375

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3172 2001-01-01 Release 2 assignment
CG3172 2001-11-29 Blastp of sequenced clone
CG3172 2003-01-01 Sim4 clustering to Release 3
twf 2008-04-29 Release 5.5 accounting
twf 2008-08-15 Release 5.9 accounting
twf 2008-12-18 5.12 accounting

Clone Sequence Records

LD37470.complete Sequence

1375 bp (1375 high quality bases) assembled on 2001-11-29

GenBank Submission: AY069613

> LD37470.complete
ATTTTTTCGGCAATATTAATTTTAGCTGTTGTCCAAATGTCTCACCAAAC
GGGTATCCGAGCCAACGAGCAGCTGGCCAAGGTGTTCGGCAAAGCGAAGA
ATGGTAAATTTCGCGTGATAAAAGTTTCGATCGAGAATGAGCAGCTTAGT
TGCGGCGCCACGGCGGAGACGAAAAAGGATTGGGAGCGCGACTACGACAA
GCTTATAGGTCCCCTACTGGAAAAGGATGTGCCCTGCTATATTCTCTATC
GCCTGGACGCCAAGATCCCGCTGGGCTACAGTTGGCTACTTATCAGCTGG
ACGCCGGACACGGCCAGCATCCGACAGAAGATGGTATACGCTTCCACGAA
GGCCACGTTGAAAACGGAGTTCGGATCAGCATACATCACAGAGGAGCTGC
ATGCCACCACTCTGGATGAGTGCACGCTGGAGGGCTATCGCCGGCACAAG
CAGGATTTCGCAGCCCCAGCTCCATTGACCAGCAGGGAGGAGGAGCTGAA
AGAGCTGCGAAAGACAGAGGTTCACACTGAGATCAATACGAATACGCGGC
ACCAAACTCTGGGTGGGATCAATTGCCCGCTGAGCGAGGCAACCGTGGCT
GCCGTTCAGGATTTGGTGCGCGGCAAGCACGACTACCTTCAGTTCCGCAT
CGATCTGGAGGAGGAACAGATCCATGTTTCGCGTGCGGCCAAAGTGGAGC
TCGCCGATCTGCCGAAGCAAGTGCCCGAGGATCATGCACGATACCACCTC
TTCCTGTTTCGGCACACGCACGAGGGCGACTACTTTGAGTCGTACGTGTT
CGTCTACTCCATGCCTGGATATTCCTGCTCCGTGCGCGAGCGCATGATGT
ACTCAAGCTGTAAGGCTCCTTTTCTCGACGAGCTCGCGGCCCTTGGCGTG
GAGGTTGTTAAGAAGCTTGAAATCGACAGCGGCAGCGAGCTGACCGAAGC
CTTCTTGCAGGACGAGCTGCACCCAAAGAAGATTCTACACCGACCGGCTT
TTGCCAAGCCCAAGGGGCCACCAAACCGAGGCGCCAAGCGCCTCACGCGT
CCCACCGCAGAGGACTAAGTCTGAATCCCGATCCCACCGAGTCAATTCTG
TTTATCGCCCTTCTACGTACTGTTTCCTAGCAGAGCATTTAATTTATTGT
ATCCAATCGTTTATTTCTTTTGTGTTGTGTCTATCCCGTGTCTATATGTG
TCCGTACGTCAGTCGATATCTTTAGAGGCACTAGGCATCAACTGAAACAT
CGCATAGCAGCCGCCAAAGTGGGCTTCCTTAAATGTATTCTTGTCTATGT
AACTTTAGATGGACATATATGCAATTTATTTAAATTAAAAAAAGTAACTA
AGTTCAAAAAAAAAAAAAAAAAAAA

LD37470.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:55:32
Subject Length Description Subject Range Query Range Score Percent Strand
twf-RA 1376 twf-RA 19..1374 1..1356 6780 100 Plus
140up-RA 1153 140up-RA 896..1153 1356..1099 1290 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:04:21
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 9947828..9948604 139..915 3795 99.2 Plus
chr3R 27901430 chr3R 9948887..9949327 914..1354 2175 99.5 Plus
chr3R 27901430 chr3R 9947648..9947727 60..139 400 100 Plus
chr3R 27901430 chr3R 9947530..9947590 1..61 305 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:32:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:04:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 14122974..14123750 139..915 3885 100 Plus
3R 32079331 3R 14124033..14124475 914..1356 2215 100 Plus
3R 32079331 3R 14122794..14122873 60..139 400 100 Plus
3R 32079331 3R 14122676..14122736 1..61 305 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:20:59
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 13863805..13864581 139..915 3885 100 Plus
3R 31820162 3R 13864864..13865306 914..1356 2215 100 Plus
3R 31820162 3R 13863625..13863704 60..139 400 100 Plus
3R 31820162 3R 13863507..13863567 1..61 305 100 Plus
Blast to na_te.dros performed 2019-03-16 22:04:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\ISBu3 993 Dbuz\ISBu3 ISBU3 993bp 253..323 12..80 116 64.8 Plus

LD37470.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:05:09 Download gff for LD37470.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 9947530..9947590 1..61 100 -> Plus
chr3R 9947650..9947727 62..139 100 -> Plus
chr3R 9947829..9948604 140..915 99 -> Plus
chr3R 9948889..9949293 916..1320 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:19:52 Download gff for LD37470.complete
Subject Subject Range Query Range Percent Splice Strand
twf-RA 1..1032 37..1068 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:26:48 Download gff for LD37470.complete
Subject Subject Range Query Range Percent Splice Strand
twf-RA 1..1032 37..1068 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:09:03 Download gff for LD37470.complete
Subject Subject Range Query Range Percent Splice Strand
twf-RA 1..1032 37..1068 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:54:14 Download gff for LD37470.complete
Subject Subject Range Query Range Percent Splice Strand
twf-RA 1..1032 37..1068 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:31:59 Download gff for LD37470.complete
Subject Subject Range Query Range Percent Splice Strand
twf-RA 1..1032 37..1068 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:03:19 Download gff for LD37470.complete
Subject Subject Range Query Range Percent Splice Strand
twf-RA 19..1373 1..1355 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:26:48 Download gff for LD37470.complete
Subject Subject Range Query Range Percent Splice Strand
twf-RA 19..1373 1..1355 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:09:03 Download gff for LD37470.complete
Subject Subject Range Query Range Percent Splice Strand
twf-RA 23..1377 1..1355 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:54:14 Download gff for LD37470.complete
Subject Subject Range Query Range Percent Splice Strand
twf-RA 19..1373 1..1355 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:31:59 Download gff for LD37470.complete
Subject Subject Range Query Range Percent Splice Strand
twf-RA 23..1377 1..1355 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:05:09 Download gff for LD37470.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14122676..14122736 1..61 100 -> Plus
3R 14122796..14122873 62..139 100 -> Plus
3R 14122975..14123750 140..915 100 -> Plus
3R 14124035..14124474 916..1355 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:05:09 Download gff for LD37470.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14122676..14122736 1..61 100 -> Plus
3R 14122796..14122873 62..139 100 -> Plus
3R 14122975..14123750 140..915 100 -> Plus
3R 14124035..14124474 916..1355 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:05:09 Download gff for LD37470.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14122676..14122736 1..61 100 -> Plus
3R 14122796..14122873 62..139 100 -> Plus
3R 14122975..14123750 140..915 100 -> Plus
3R 14124035..14124474 916..1355 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:09:03 Download gff for LD37470.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9948398..9948458 1..61 100 -> Plus
arm_3R 9948518..9948595 62..139 100 -> Plus
arm_3R 9948697..9949472 140..915 100 -> Plus
arm_3R 9949757..9950196 916..1355 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:30:20 Download gff for LD37470.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13863806..13864581 140..915 100 -> Plus
3R 13864866..13865305 916..1355 100   Plus
3R 13863507..13863567 1..61 100 -> Plus
3R 13863627..13863704 62..139 100 -> Plus

LD37470.hyp Sequence

Translation from 0 to 1067

> LD37470.hyp
IFSAILILAVVQMSHQTGIRANEQLAKVFGKAKNGKFRVIKVSIENEQLS
CGATAETKKDWERDYDKLIGPLLEKDVPCYILYRLDAKIPLGYSWLLISW
TPDTASIRQKMVYASTKATLKTEFGSAYITEELHATTLDECTLEGYRRHK
QDFAAPAPLTSREEELKELRKTEVHTEINTNTRHQTLGGINCPLSEATVA
AVQDLVRGKHDYLQFRIDLEEEQIHVSRAAKVELADLPKQVPEDHARYHL
FLFRHTHEGDYFESYVFVYSMPGYSCSVRERMMYSSCKAPFLDELAALGV
EVVKKLEIDSGSELTEAFLQDELHPKKILHRPAFAKPKGPPNRGAKRLTR
PTAED*

LD37470.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:07:17
Subject Length Description Subject Range Query Range Score Percent Strand
twf-PA 343 CG3172-PA 1..343 13..355 1796 100 Plus

LD37470.pep Sequence

Translation from 36 to 1067

> LD37470.pep
MSHQTGIRANEQLAKVFGKAKNGKFRVIKVSIENEQLSCGATAETKKDWE
RDYDKLIGPLLEKDVPCYILYRLDAKIPLGYSWLLISWTPDTASIRQKMV
YASTKATLKTEFGSAYITEELHATTLDECTLEGYRRHKQDFAAPAPLTSR
EEELKELRKTEVHTEINTNTRHQTLGGINCPLSEATVAAVQDLVRGKHDY
LQFRIDLEEEQIHVSRAAKVELADLPKQVPEDHARYHLFLFRHTHEGDYF
ESYVFVYSMPGYSCSVRERMMYSSCKAPFLDELAALGVEVVKKLEIDSGS
ELTEAFLQDELHPKKILHRPAFAKPKGPPNRGAKRLTRPTAED*

LD37470.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 10:36:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16237-PA 343 GF16237-PA 1..343 1..343 1705 90.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 10:36:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16839-PA 343 GG16839-PA 1..343 1..343 1841 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 10:36:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19702-PA 342 GH19702-PA 1..340 1..343 1535 81 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:21:08
Subject Length Description Subject Range Query Range Score Percent Strand
twf-PA 343 CG3172-PA 1..343 1..343 1796 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 10:36:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23039-PA 345 GI23039-PA 1..343 1..343 1576 81.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 10:36:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24238-PA 345 GL24238-PA 1..343 1..343 1662 88.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:36:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16421-PA 345 GA16421-PA 1..343 1..343 1666 88.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 10:36:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24151-PA 343 GM24151-PA 1..343 1..343 1833 99.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 10:36:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18947-PA 341 GD18947-PA 1..341 1..343 1770 96.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 10:36:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24628-PA 345 GJ24628-PA 1..343 1..343 1583 83.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 10:36:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12190-PA 345 GK12190-PA 1..343 1..343 1657 87.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 10:36:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24220-PA 343 GE24220-PA 1..343 1..343 1838 99.7 Plus