Clone LD37523 Report

Search the DGRC for LD37523

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:375
Well:23
Vector:pOT2
Associated Gene/Transcriptatms-RA
Protein status:LD37523.pep: gold
Preliminary Size:1891
Sequenced Size:1771

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2503 2001-01-01 Release 2 assignment
CG2503 2001-12-12 Blastp of sequenced clone
CG2503 2003-01-01 Sim4 clustering to Release 3
atms 2008-04-29 Release 5.5 accounting
atms 2008-08-15 Release 5.9 accounting
atms 2008-12-18 5.12 accounting

Clone Sequence Records

LD37523.complete Sequence

1771 bp (1771 high quality bases) assembled on 2001-12-12

GenBank Submission: AY070561

> LD37523.complete
TGAGGATTTCTAGATTTGGCCTCTTGATGGACTAGAAGCGCTACCAAAAC
TGGGGCTTGAGTTGAATTACCTGTTGGAAGACACAATGCCACCCACGATC
AACAATTCGGCGGTAAACAGTGCCGCCGAAAAGCGACCCCAGCGGCAAAC
GGAGCGCAAATCCGAGATCATTTGCCGCGTGAAGTATGGAAACAACCTGC
CGGATATACCATTTGATCTGAAGTTTCTGCAGTACCCCTTCGACAGCCAC
CGCTTCGTGCAGTACAACCCAACGTCGCTAGAGCGTAACTTCAAGTATGA
CGTGCTGACGGAACACGATTTGGGTGTCACGGTGGACCTGATTAACCGGG
AGCTCTATCAGGCCGACTCCATGACGCTGCTGGACCCCGCCGATGAAAAA
CTGCTGGAGGAGGAGACTCTGACGCCCACAGACTCTGTGCGTTCGCGCCA
GCATTCGAGGACGGTGTCATGGTTGCGCAAATCCGAGTACATCTCCACCG
AGCAGACGCGCTTCCAGCCCCAGAACCTGGAGAACATCGAGGCCAAGGTC
GGTTACAACGTCAAGAAGTCGCTTCGGGAGGAGACTCTCTACCTGGACCG
CGAAGCCCAGATCAAAGCCATCGAGAAGACCTTCAGCGACACCAAGAGCG
AAATTACCAAGCACTATTCCAAGCCCAATGTGGTGCCAGTGGAGGTACTG
CCTATCTTCCCCGACTTCACCAACTGGAAGTTCCCGTGCGCCCAGGTCAT
ATTTGACAGTGATCCCGCTCCTGCGGGCAAGAACGTGCCCGCCCAGCTGG
AGGAGATGTCGCAGGCCATGATTCGTGGTGTGATGGACGAGAGCGGCGAA
CAGTTTGTCGCCTACTTCCTGCCCACAGAGCAGACGCTGGAGAAACGCCG
TACAGACTTCATCAATGGCGAGCTGTACAAGGAGGAGGAGGAGTACGAGT
ACAAGATCGCTCGAGAGTACAACTGGAACGTGAAGACCAAAGCTTCCAAG
GGCTACGAAGAAAACTACTTCTTCGTGATGCGTCAGGACGGCATCTACTA
CAACGAGCTAGAAACCCGTGTGCGCCTTAACAAGCGTCGCGTTAAGGTTG
GCCAGCAACCCAACAACACCAAGCTGGTTGTCAAGCATCGTCCATTGGAC
AGCATGGAGCATCGTATGCAGCGCTATCGCGAGCGCCAGCTAGAAGTTCC
TGGCGAGGAGGAGGAGATCGTGGAAGAAGTGAGGGAAGAGGAGCAAATGC
AAATCATTGGCGAGACGGAGAAGACGAGCGAGGACGCAGCTGTTGGCGCA
CAGGCAGCATCTGGAGCGGACTCACCCGCCCAGGTAGCCCGCGATCGACA
GTCTCGTTCTCGGAGTCGAACTCGCAGCGGGTCCAGTTCAGGATCTGGAT
CTGGCTCCGGCTCTCGGGCCAGCAGCCGCTCAAAGTCTGGTTCTCGGTCT
GGTAGCGGCTCCAGATCACGCACAAATTCGCCGGCAGGATCCCAGAAATC
CGGATCCAGATCGAGATCGGTATCACGTTCCCGATCCCGTTCCAAGTCCG
GCTCTCGGTCGCGTTCTAGGTCGAGATCCAAGTCCGGTTCCCGATCACGT
TCGGGCTCCAGATCTGGCTCTGGGTCGCGATCGCCCAGCCGGTCTCGCAG
TGGCTCGCCTTCTGGTTCAGGATCCAGCTCTGGAAGCGCCTCAGATGAAT
GATTAATTACAAAAAACGGCGTTCATAATAAATAAGTTTATAATCAACCA
AGTAAAAAAAAAAAAAAAAAA

LD37523.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:49:47
Subject Length Description Subject Range Query Range Score Percent Strand
atms-RA 2102 atms-RA 137..1890 1..1754 8770 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:25:10
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 601534..602506 156..1128 4850 99.9 Plus
chr3R 27901430 chr3R 602563..603190 1126..1753 3140 100 Plus
chr3R 27901430 chr3R 601321..601479 1..159 795 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:32:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:25:08
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 4775834..4776806 156..1128 4850 99.9 Plus
3R 32079331 3R 4776863..4777491 1126..1754 3145 100 Plus
3R 32079331 3R 4775621..4775779 1..159 795 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:15:49
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 4516665..4517637 156..1128 4850 99.8 Plus
3R 31820162 3R 4517694..4518322 1126..1754 3145 100 Plus
3R 31820162 3R 4516452..4516610 1..159 795 100 Plus
Blast to na_te.dros performed on 2019-03-16 01:25:09 has no hits.

LD37523.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:26:12 Download gff for LD37523.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 601321..601479 1..159 100 -> Plus
chr3R 601538..602504 160..1126 100 -> Plus
chr3R 602564..603190 1127..1753 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:19:54 Download gff for LD37523.complete
Subject Subject Range Query Range Percent Splice Strand
atms-RA 1..1617 86..1702 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:18:44 Download gff for LD37523.complete
Subject Subject Range Query Range Percent Splice Strand
atms-RA 1..1617 86..1702 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:06:06 Download gff for LD37523.complete
Subject Subject Range Query Range Percent Splice Strand
atms-RA 1..1617 86..1702 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:44:53 Download gff for LD37523.complete
Subject Subject Range Query Range Percent Splice Strand
atms-RA 1..1617 86..1702 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:33:35 Download gff for LD37523.complete
Subject Subject Range Query Range Percent Splice Strand
atms-RA 1..1617 86..1702 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:51:52 Download gff for LD37523.complete
Subject Subject Range Query Range Percent Splice Strand
atms-RA 21..1773 1..1753 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:18:44 Download gff for LD37523.complete
Subject Subject Range Query Range Percent Splice Strand
atms-RA 21..1773 1..1753 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:06:06 Download gff for LD37523.complete
Subject Subject Range Query Range Percent Splice Strand
atms-RA 17..1769 1..1753 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:44:53 Download gff for LD37523.complete
Subject Subject Range Query Range Percent Splice Strand
atms-RA 21..1773 1..1753 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:33:35 Download gff for LD37523.complete
Subject Subject Range Query Range Percent Splice Strand
atms-RA 17..1769 1..1753 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:26:12 Download gff for LD37523.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4775621..4775779 1..159 100 -> Plus
3R 4775838..4776804 160..1126 100 -> Plus
3R 4776864..4777490 1127..1753 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:26:12 Download gff for LD37523.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4775621..4775779 1..159 100 -> Plus
3R 4775838..4776804 160..1126 100 -> Plus
3R 4776864..4777490 1127..1753 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:26:12 Download gff for LD37523.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4775621..4775779 1..159 100 -> Plus
3R 4775838..4776804 160..1126 100 -> Plus
3R 4776864..4777490 1127..1753 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:06:06 Download gff for LD37523.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 601343..601501 1..159 100 -> Plus
arm_3R 601560..602526 160..1126 100 -> Plus
arm_3R 602586..603212 1127..1753 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:21:10 Download gff for LD37523.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4516669..4517635 160..1126 100 -> Plus
3R 4517695..4518321 1127..1753 100   Plus
3R 4516452..4516610 1..159 100 -> Plus

LD37523.hyp Sequence

Translation from 85 to 1701

> LD37523.hyp
MPPTINNSAVNSAAEKRPQRQTERKSEIICRVKYGNNLPDIPFDLKFLQY
PFDSHRFVQYNPTSLERNFKYDVLTEHDLGVTVDLINRELYQADSMTLLD
PADEKLLEEETLTPTDSVRSRQHSRTVSWLRKSEYISTEQTRFQPQNLEN
IEAKVGYNVKKSLREETLYLDREAQIKAIEKTFSDTKSEITKHYSKPNVV
PVEVLPIFPDFTNWKFPCAQVIFDSDPAPAGKNVPAQLEEMSQAMIRGVM
DESGEQFVAYFLPTEQTLEKRRTDFINGELYKEEEEYEYKIAREYNWNVK
TKASKGYEENYFFVMRQDGIYYNELETRVRLNKRRVKVGQQPNNTKLVVK
HRPLDSMEHRMQRYRERQLEVPGEEEEIVEEVREEEQMQIIGETEKTSED
AAVGAQAASGADSPAQVARDRQSRSRSRTRSGSSSGSGSGSGSRASSRSK
SGSRSGSGSRSRTNSPAGSQKSGSRSRSVSRSRSRSKSGSRSRSRSRSKS
GSRSRSGSRSGSGSRSPSRSRSGSPSGSGSSSGSASDE*

LD37523.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:50:34
Subject Length Description Subject Range Query Range Score Percent Strand
atms-PB 538 CG2503-PB 1..538 1..538 2734 100 Plus
atms-PA 538 CG2503-PA 1..538 1..538 2734 100 Plus
CG2469-PA 1150 CG2469-PA 927..1143 339..536 314 42.4 Plus
CG2469-PB 1150 CG2469-PB 927..1143 339..536 314 42.4 Plus
CG9915-PC 820 CG9915-PC 312..457 407..538 216 55.4 Plus
CG2469-PA 1150 CG2469-PA 1049..1150 407..499 178 52.3 Plus
CG2469-PB 1150 CG2469-PB 1049..1150 407..499 178 52.3 Plus
CG2469-PA 1150 CG2469-PA 838..1057 366..538 170 32.7 Plus
CG2469-PB 1150 CG2469-PB 838..1057 366..538 170 32.7 Plus

LD37523.pep Sequence

Translation from 85 to 1701

> LD37523.pep
MPPTINNSAVNSAAEKRPQRQTERKSEIICRVKYGNNLPDIPFDLKFLQY
PFDSHRFVQYNPTSLERNFKYDVLTEHDLGVTVDLINRELYQADSMTLLD
PADEKLLEEETLTPTDSVRSRQHSRTVSWLRKSEYISTEQTRFQPQNLEN
IEAKVGYNVKKSLREETLYLDREAQIKAIEKTFSDTKSEITKHYSKPNVV
PVEVLPIFPDFTNWKFPCAQVIFDSDPAPAGKNVPAQLEEMSQAMIRGVM
DESGEQFVAYFLPTEQTLEKRRTDFINGELYKEEEEYEYKIAREYNWNVK
TKASKGYEENYFFVMRQDGIYYNELETRVRLNKRRVKVGQQPNNTKLVVK
HRPLDSMEHRMQRYRERQLEVPGEEEEIVEEVREEEQMQIIGETEKTSED
AAVGAQAASGADSPAQVARDRQSRSRSRTRSGSSSGSGSGSGSRASSRSK
SGSRSGSGSRSRTNSPAGSQKSGSRSRSVSRSRSRSKSGSRSRSRSRSKS
GSRSRSGSRSGSGSRSPSRSRSGSPSGSGSSSGSASDE*

LD37523.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:12:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18911-PA 548 GF18911-PA 1..478 1..474 1979 88.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:12:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12571-PA 538 GG12571-PA 1..473 1..471 2077 94.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:12:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22996-PA 566 GH22996-PA 1..373 1..373 1957 94.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:03:41
Subject Length Description Subject Range Query Range Score Percent Strand
atms-PB 538 CG2503-PB 1..538 1..538 2734 100 Plus
atms-PA 538 CG2503-PA 1..538 1..538 2734 100 Plus
Ctr9-PA 1150 CG2469-PA 927..1143 339..536 314 42.4 Plus
Ctr9-PB 1150 CG2469-PB 927..1143 339..536 314 42.4 Plus
CG9915-PC 820 CG9915-PC 312..457 407..538 216 55.4 Plus
CG9915-PB 820 CG9915-PB 312..457 407..538 216 55.4 Plus
CG6695-PB 715 CG6695-PB 370..526 391..531 215 43.3 Plus
Atu-PA 725 CG1433-PA 133..246 419..533 215 48.7 Plus
CG6695-PA 961 CG6695-PA 370..526 391..531 215 43.3 Plus
CG9915-PC 820 CG9915-PC 259..402 396..536 206 51.4 Plus
CG9915-PB 820 CG9915-PB 259..402 396..536 206 51.4 Plus
CG9915-PC 820 CG9915-PC 334..460 406..531 204 52.3 Plus
CG9915-PB 820 CG9915-PB 334..460 406..531 204 52.3 Plus
CG9915-PC 820 CG9915-PC 144..276 407..534 201 50.7 Plus
CG9915-PC 820 CG9915-PC 234..367 419..536 201 52.5 Plus
CG9915-PB 820 CG9915-PB 144..276 407..534 201 50.7 Plus
CG9915-PB 820 CG9915-PB 234..367 419..536 201 52.5 Plus
B52-PO 355 CG10851-PO 14..345 248..531 201 30.1 Plus
B52-PM 355 CG10851-PM 14..345 248..531 201 30.1 Plus
B52-PN 350 CG10851-PN 192..340 409..531 200 46.3 Plus
B52-PC 350 CG10851-PC 192..340 409..531 200 46.3 Plus
B52-PA 350 CG10851-PA 192..340 409..531 200 46.3 Plus
CG9915-PC 820 CG9915-PC 226..348 421..536 194 57 Plus
CG9915-PB 820 CG9915-PB 226..348 421..536 194 57 Plus
CG9915-PC 820 CG9915-PC 166..312 398..535 193 51 Plus
CG9915-PB 820 CG9915-PB 166..312 398..535 193 51 Plus
CG9915-PC 820 CG9915-PC 50..223 390..536 190 43.8 Plus
CG9915-PB 820 CG9915-PB 50..223 390..536 190 43.8 Plus
CG9915-PC 820 CG9915-PC 144..295 401..536 188 44.9 Plus
CG9915-PB 820 CG9915-PB 144..295 401..536 188 44.9 Plus
CG9915-PC 820 CG9915-PC 108..258 401..534 187 48.4 Plus
CG9915-PB 820 CG9915-PB 108..258 401..534 187 48.4 Plus
B52-PB 329 CG10851-PB 14..318 248..521 184 29.1 Plus
PNUTS-PA 628 CG33526-PA 272..423 396..538 182 40.5 Plus
PNUTS-PB 628 CG33526-PB 272..423 396..538 182 40.5 Plus
PNUTS-PE 1135 CG33526-PE 272..423 396..538 182 40.5 Plus
PNUTS-PD 1135 CG33526-PD 272..423 396..538 182 40.5 Plus
CG9915-PC 820 CG9915-PC 168..330 393..536 181 46.7 Plus
CG9915-PB 820 CG9915-PB 168..330 393..536 181 46.7 Plus
B52-PN 350 CG10851-PN 187..303 430..536 181 50.8 Plus
B52-PN 350 CG10851-PN 191..305 430..536 181 49.6 Plus
B52-PC 350 CG10851-PC 187..303 430..536 181 50.8 Plus
B52-PC 350 CG10851-PC 191..305 430..536 181 49.6 Plus
B52-PA 350 CG10851-PA 187..303 430..536 181 50.8 Plus
B52-PA 350 CG10851-PA 191..305 430..536 181 49.6 Plus
B52-PB 329 CG10851-PB 192..308 430..536 181 50.8 Plus
B52-PB 329 CG10851-PB 196..310 430..536 181 49.6 Plus
Mur89F-PC 2158 CG4090-PC 536..691 385..538 180 33.3 Plus
Mur89F-PB 2159 CG4090-PB 536..691 385..538 180 33.3 Plus
CG9915-PC 820 CG9915-PC 247..376 404..534 179 49.3 Plus
CG9915-PB 820 CG9915-PB 247..376 404..534 179 49.3 Plus
Ctr9-PA 1150 CG2469-PA 1049..1150 407..499 178 52.3 Plus
Ctr9-PB 1150 CG2469-PB 1049..1150 407..499 178 52.3 Plus
CG2926-PA 2296 CG2926-PA 1075..1235 365..536 178 34.9 Plus
CG31211-PA 874 CG31211-PA 671..810 399..535 174 38.3 Plus
CG31211-PB 893 CG31211-PB 690..829 399..535 174 38.3 Plus
Srp54-PA 513 CG4602-PA 315..448 409..535 173 39.7 Plus
Ctr9-PA 1150 CG2469-PA 838..1057 366..538 170 32.7 Plus
Ctr9-PB 1150 CG2469-PB 838..1057 366..538 170 32.7 Plus
Mur89F-PC 2158 CG4090-PC 1091..1197 423..536 170 40.4 Plus
Mur89F-PB 2159 CG4090-PB 1091..1197 423..536 170 40.4 Plus
RnpS1-PA 374 CG16788-PA 3..215 365..526 168 33.3 Plus
PNUTS-PA 628 CG33526-PA 263..404 399..538 167 34.7 Plus
PNUTS-PB 628 CG33526-PB 263..404 399..538 167 34.7 Plus
PNUTS-PE 1135 CG33526-PE 263..404 399..538 167 34.7 Plus
PNUTS-PD 1135 CG33526-PD 263..404 399..538 167 34.7 Plus
Atu-PA 725 CG1433-PA 3..148 394..535 165 41.6 Plus
Xe7-PD 777 CG2179-PD 582..697 421..525 165 47.5 Plus
SRm160-PA 954 CG11274-PA 121..316 312..521 163 32.5 Plus
Mur89F-PC 2158 CG4090-PC 313..459 398..536 162 30.6 Plus
Mur89F-PB 2159 CG4090-PB 313..459 398..536 162 30.6 Plus
Mur89F-PC 2158 CG4090-PC 290..439 395..538 161 28 Plus
Mur89F-PB 2159 CG4090-PB 290..439 395..538 161 28 Plus
Srp54-PA 513 CG4602-PA 197..410 340..538 161 34.3 Plus
Mur89F-PC 2158 CG4090-PC 336..472 395..537 158 30.1 Plus
Mur89F-PC 2158 CG4090-PC 535..679 394..538 158 31.5 Plus
Mur89F-PB 2159 CG4090-PB 336..472 395..537 158 30.1 Plus
Mur89F-PB 2159 CG4090-PB 535..679 394..538 158 31.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:12:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10242-PA 575 GI10242-PA 1..373 1..373 1960 94.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:12:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21617-PA 559 GL21617-PA 1..521 1..510 2055 84.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:12:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15378-PA 559 GA15378-PA 1..521 1..510 2055 84.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:12:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10775-PA 538 GM10775-PA 1..538 1..538 2809 99.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:13:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19748-PA 538 GD19748-PA 1..538 1..538 2809 99.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:13:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11046-PA 567 GJ11046-PA 1..527 1..497 1946 79.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:13:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12821-PA 543 GK12821-PA 1..516 1..512 1902 74.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:13:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25435-PA 536 GE25435-PA 1..472 1..470 2093 92.6 Plus