Clone LD37787 Report

Search the DGRC for LD37787

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:377
Well:87
Vector:pOT2
Associated Gene/TranscriptPu-RA
Protein status:LD37787.pep: gold
Preliminary Size:1963
Sequenced Size:1805

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9441 2001-07-04 Blastp of sequenced clone
CG9441 2003-01-01 Sim4 clustering to Release 3
Pu 2008-04-29 Release 5.5 accounting
Pu 2008-08-15 Release 5.9 accounting
Pu 2008-12-18 5.12 accounting

Clone Sequence Records

LD37787.complete Sequence

1805 bp (1805 high quality bases) assembled on 2001-07-04

GenBank Submission: AY051890

> LD37787.complete
CCACCCGAAGCGCCAACACGCGAAGACAAAGTCCGGCAGACAGCAGCGCA
AAAAGAGACAGATAGCAGTGAGAAAATCATCGAGGAAAAAAGATTGTGTG
CTAGCCGTCAAATTGAGTTCCATTCGAGTGGCAAACAAACCTGAGTAGCC
GCACCGCCATGAGCTTTACCCGCCAACTGTCCGAGATGAGTGCCAGCGAG
CTGAACGATGCCATCGACGACACCAACTTCCCGCAGGCCCACATCCTTTC
GCGCGGACGCAACAACAGCGTCTGCTCAACAAGTAGCACCTCGGGCACCT
CCTCGCTGGCGGACAGGCAGCAGAACCAGGCGGAGGAGGCCACTGCCATT
GCGGGCACACCCGTCGAGGAGGTGGCGCCAGCTCCTGCTCTCGTCCCGTT
GGCCGGCAACCAGAGACCCCGCCTCATCCTGAAGACCAACGGCAGCAGTC
CGGATAGTGATGGTACACAACCGAAAACACCACTGACACCGCGTACATCG
ACAACGCCAGGCCACGAGAAGTGCACGTTCCACCACGACCTGGAGCTGGA
CCACAAGCCGCCGACGCGAGAGGCCCTCCTTCCGGACATGGCACGCTCGT
ATCGTCTACTCTTGGGCGGCCTGGGCGAGAATCCCGATCGCCAGGGACTG
ATCAAGACGCCGGAGCGGGCAGCCAAGGCCATGCTGTACTTCACCAAGGG
CTACGACCAGAGTCTCGAGGATGTTCTCAATGGCGCCGTTTTCGACGAGG
ATCATGACGAAATGGTGGTGGTCAAGGATATTGAAATGTTCTCCATGTGC
GAGCATCATCTGGTGCCCTTCTACGGCAAAGTTTCCATCGGTTATTTGCC
GTGCAACAAGATTCTCGGACTCAGTAAATTGGCACGCATTGTCGAAATAT
TTTCGCGTCGCCTGCAAGTCCAGGAGCGCTTAACTAAGCAGATCGCAGTG
GCCGTGACTCAGGCCGTGCAACCCGCTGGAGTAGCAGTGGTCGTAGAGGG
AGTCCACATGTGCATGGTGATGCGTGGCGTGCAGAAGATCAACAGCAAAA
CTGTTACCTCAACTATGCTGGGCGTGTTCCGAGACGATCCCAAGACCCGT
GAGGAATTCCTGAACTTAGTCAATAGCAAATAGAGTGGGCACTAGAGGAC
GCTACTGAAATCCGAGACCAACTAAACCCCTACAATATTTTTGGAGGCGC
TTATATACAAACAAACAAAAATGAAACGAAACACAGGGTCCATTAGTTTA
TGTTTTTAGGATTGATTTCATTTAGTTAGTGCAATGATTGCGCAGCCATT
TTCCTTGTTGATTTGTGTAAAAATTGTTGAAAAATTTTGTTAGCAAAATA
CGTTTTTTAGATAGATGAATGTAATGAGAAGCGAGATTCGAAGAGGACGA
GATTTGAATACCGGTGTTGGGTAGTTTTATGTTCAATTTTATATGCAGTT
TTATGGCACTTGAACGATAATTTTTACAACGTATACATACGATTAATGCA
TTGTGCAATAAGGGAACAACTGATAATAAATCACGGCAAATTGTTTAGGG
AATTTACAATTTATAAACAGTTCACATCAAATTAATCAGATCTATAGTTA
TGTATGTATGTTAACCTATATAAAGAGTTGCATTCATAATGTTCCTCGAC
AGGGACCAAAGTATATTGGAAGATTTTAAATGTTAAAATTATATGCTCAT
TATGTAAATGACGTTGCTTGTAGTGAGTCAAAGCTGCTTATTAATTATAC
AATAAATTATGTATTTAAATAACGTTAAAAAAAAAAAAAAAAAAAAAAAA
AAAAA

LD37787.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:29:41
Subject Length Description Subject Range Query Range Score Percent Strand
Pu-RA 1823 Pu-RA 40..1819 1..1780 8900 100 Plus
Pu.a 1803 Pu.a 17..1799 1..1780 8845 99.8 Plus
Pu.b 1806 Pu.b 532..1802 510..1780 6355 100 Plus
Pu.b 1806 Pu.b 17..527 1..511 2555 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:00:42
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 17068294..17069065 1004..1776 3770 99.5 Plus
chr2R 21145070 chr2R 17065597..17066107 1..511 2450 98.6 Plus
chr2R 21145070 chr2R 17066398..17066610 508..720 1065 100 Plus
chr2R 21145070 chr2R 17067877..17068043 720..886 835 100 Plus
chr2R 21145070 chr2R 17068102..17068219 886..1003 575 99.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:32:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:00:40
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21181836..21182612 1004..1780 3885 100 Plus
2R 25286936 2R 21179135..21179645 1..511 2555 100 Plus
2R 25286936 2R 21179935..21180147 508..720 1065 100 Plus
2R 25286936 2R 21181419..21181585 720..886 835 100 Plus
2R 25286936 2R 21181644..21181761 886..1003 590 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:52:00
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 21183035..21183811 1004..1780 3885 100 Plus
2R 25260384 2R 21180334..21180844 1..511 2555 100 Plus
2R 25260384 2R 21181134..21181346 508..720 1065 100 Plus
2R 25260384 2R 21182618..21182784 720..886 835 100 Plus
2R 25260384 2R 21182843..21182960 886..1003 590 100 Plus
Blast to na_te.dros performed on 2019-03-16 06:00:41 has no hits.

LD37787.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:01:21 Download gff for LD37787.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 17065597..17066106 1..510 98 -> Plus
chr2R 17066401..17066610 511..720 100 -> Plus
chr2R 17067878..17068043 721..886 100 -> Plus
chr2R 17068103..17068219 887..1003 99 -> Plus
chr2R 17068294..17069024 1004..1735 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:20:05 Download gff for LD37787.complete
Subject Subject Range Query Range Percent Splice Strand
Pu-RA 1..975 159..1133 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:17:31 Download gff for LD37787.complete
Subject Subject Range Query Range Percent Splice Strand
Pu-RA 1..975 159..1133 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:14:24 Download gff for LD37787.complete
Subject Subject Range Query Range Percent Splice Strand
Pu-RA 1..975 159..1133 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:49:02 Download gff for LD37787.complete
Subject Subject Range Query Range Percent Splice Strand
Pu-RA 1..975 159..1133 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:12:52 Download gff for LD37787.complete
Subject Subject Range Query Range Percent Splice Strand
Pu-RA 1..975 159..1133 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:12:19 Download gff for LD37787.complete
Subject Subject Range Query Range Percent Splice Strand
Pu-RA 17..1792 1..1776 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:17:31 Download gff for LD37787.complete
Subject Subject Range Query Range Percent Splice Strand
Pu-RA 17..1792 1..1776 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:14:24 Download gff for LD37787.complete
Subject Subject Range Query Range Percent Splice Strand
Pu-RA 18..1793 1..1776 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:49:02 Download gff for LD37787.complete
Subject Subject Range Query Range Percent Splice Strand
Pu-RA 17..1792 1..1776 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:12:52 Download gff for LD37787.complete
Subject Subject Range Query Range Percent Splice Strand
Pu-RA 18..1793 1..1776 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:01:21 Download gff for LD37787.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21179135..21179644 1..510 100 -> Plus
2R 21179938..21180147 511..720 100 -> Plus
2R 21181420..21181585 721..886 100 -> Plus
2R 21181645..21181761 887..1003 100 -> Plus
2R 21181836..21182608 1004..1776 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:01:21 Download gff for LD37787.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21179135..21179644 1..510 100 -> Plus
2R 21179938..21180147 511..720 100 -> Plus
2R 21181420..21181585 721..886 100 -> Plus
2R 21181645..21181761 887..1003 100 -> Plus
2R 21181836..21182608 1004..1776 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:01:21 Download gff for LD37787.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21179135..21179644 1..510 100 -> Plus
2R 21179938..21180147 511..720 100 -> Plus
2R 21181420..21181585 721..886 100 -> Plus
2R 21181645..21181761 887..1003 100 -> Plus
2R 21181836..21182608 1004..1776 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:14:24 Download gff for LD37787.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17066640..17067149 1..510 100 -> Plus
arm_2R 17067443..17067652 511..720 100 -> Plus
arm_2R 17068925..17069090 721..886 100 -> Plus
arm_2R 17069150..17069266 887..1003 100 -> Plus
arm_2R 17069341..17070113 1004..1776 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:27:12 Download gff for LD37787.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21180334..21180843 1..510 100 -> Plus
2R 21181137..21181346 511..720 100 -> Plus
2R 21182619..21182784 721..886 100 -> Plus
2R 21182844..21182960 887..1003 100 -> Plus
2R 21183035..21183807 1004..1776 100   Plus

LD37787.hyp Sequence

Translation from 158 to 1132

> LD37787.hyp
MSFTRQLSEMSASELNDAIDDTNFPQAHILSRGRNNSVCSTSSTSGTSSL
ADRQQNQAEEATAIAGTPVEEVAPAPALVPLAGNQRPRLILKTNGSSPDS
DGTQPKTPLTPRTSTTPGHEKCTFHHDLELDHKPPTREALLPDMARSYRL
LLGGLGENPDRQGLIKTPERAAKAMLYFTKGYDQSLEDVLNGAVFDEDHD
EMVVVKDIEMFSMCEHHLVPFYGKVSIGYLPCNKILGLSKLARIVEIFSR
RLQVQERLTKQIAVAVTQAVQPAGVAVVVEGVHMCMVMRGVQKINSKTVT
STMLGVFRDDPKTREEFLNLVNSK*

LD37787.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:19:56
Subject Length Description Subject Range Query Range Score Percent Strand
Pu-PA 324 CG9441-PA 1..324 1..324 1660 100 Plus
Pu-PC 308 CG9441-PC 1..308 1..324 1546 95.1 Plus
Pu-PB 273 CG9441-PB 63..273 114..324 1071 98.6 Plus

LD37787.pep Sequence

Translation from 158 to 1132

> LD37787.pep
MSFTRQLSEMSASELNDAIDDTNFPQAHILSRGRNNSVCSTSSTSGTSSL
ADRQQNQAEEATAIAGTPVEEVAPAPALVPLAGNQRPRLILKTNGSSPDS
DGTQPKTPLTPRTSTTPGHEKCTFHHDLELDHKPPTREALLPDMARSYRL
LLGGLGENPDRQGLIKTPERAAKAMLYFTKGYDQSLEDVLNGAVFDEDHD
EMVVVKDIEMFSMCEHHLVPFYGKVSIGYLPCNKILGLSKLARIVEIFSR
RLQVQERLTKQIAVAVTQAVQPAGVAVVVEGVHMCMVMRGVQKINSKTVT
STMLGVFRDDPKTREEFLNLVNSK*

LD37787.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:57:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11941-PA 285 GF11941-PA 75..285 114..324 1066 98.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:57:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22097-PA 271 GG22097-PA 61..271 114..324 1134 98.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:57:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20729-PA 337 GH20729-PA 1..337 1..324 1363 85.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:06:57
Subject Length Description Subject Range Query Range Score Percent Strand
Pu-PA 324 CG9441-PA 1..324 1..324 1660 100 Plus
Pu-PC 308 CG9441-PC 1..308 1..324 1546 95.1 Plus
Pu-PB 273 CG9441-PB 63..273 114..324 1071 98.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:57:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20812-PA 274 GI20812-PA 68..274 118..324 1057 99 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:57:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10161-PA 274 GL10161-PA 68..274 118..324 1057 99.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:57:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA30270-PB 325 GA30270-PB 1..325 1..324 1445 89.7 Plus
Dpse\GA30270-PA 277 GA30270-PA 72..277 119..324 1052 99.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:57:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15814-PA 273 GM15814-PA 63..273 114..324 1135 98.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:57:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11572-PA 273 GD11572-PA 63..273 114..324 1135 98.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:57:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20545-PA 270 GJ20545-PA 64..270 118..324 1056 99 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:57:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21906-PA 321 GK21906-PA 1..321 1..324 1421 86.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:57:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12177-PA 271 GE12177-PA 61..271 114..324 1131 98.1 Plus