Clone LD37852 Report

Search the DGRC for LD37852

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:378
Well:52
Vector:pOT2
Associated Gene/TranscriptAld-RB
Protein status:LD37852.pep: gold
Preliminary Size:1651
Sequenced Size:1505

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6058 2001-09-19 Blastp of sequenced clone
CG6058 2003-01-01 Sim4 clustering to Release 3
Ald 2008-04-29 Release 5.5 accounting
Ald 2008-08-15 Release 5.9 accounting
Ald 2008-12-18 5.12 accounting
CG6058 2011-03-01 Transcript Validation

Clone Sequence Records

LD37852.complete Sequence

1505 bp (1505 high quality bases) assembled on 2001-09-19

GenBank Submission: AY058667

> LD37852.complete
CACCGTCGGCGACGACCTCCAAACAACCTTTTGGGGTCTCGCTCGGCATG
TCTCGCTTATTTCGCTTTGGAATTTCACGTTGACGCCGCAGTCAGCGGTA
GCAGAGGCATCGGCAGCGGCAGTAGCAGCGACACGGGCCGAAAATAAAAG
CGTTAACCGCTCTCCTCCAGTGCAGCAGCAGCAGCGGACCCAGCCAGTAG
CCAGCAGCTAATCACCACATCCCAGATTCAGTTTCCAGTTCGAACTACAC
TCGAATCTCAAAAATGACGACCTACTTCAACTACCCCAGCAAGGAGCTGC
AGGATGAGCTGCGCGAAATCGCCCAGAAAATCGTTGCCCCCGGCAAGGGA
ATCCTCGCCGCCGATGAGTCCGGCCCAACCATGGGCAAGCGTCTGCAGGA
CATCGGCGTGGAGAACACCGAGGACAACCGCCGTGCCTACCGTCAGCTGT
TGTTCAGCACTGACCCCAAGCTGGCCGAGAACATCTCTGGAGTGATCCTG
TTCCACGAGACCCTCTACCAGAAGGCCGATGATGGCACCCCCTTCGCCGA
GATCCTGAAGAAGAAGGGAATCATTCTGGGCATCAAGGTCGACAAGGGTG
TTGTCCCACTGTTCGGCTCTGAGGATGAGGTCACCACCCAGGGTCTGGAT
GACCTGGCCGCCCGTTGCGCCCAGTACAAGAAGGACGGTTGCGACTTCGC
CAAGTGGCGTTGCGTCCTGAAGATCGGCAAGAACACCCCATCCTACCAGT
CGATCCTGGAGAACGCCAATGTCCTGGCCCGCTACGCCTCCATCTGCCAG
TCGCAGCGCATCGTCCCAATTGTGGAGCCCGAGGTTCTGCCCGATGGCGA
TCACGATCTGGACCGCGCCCAGAAGGTCACCGAGACCGTCCTGGCCGCCG
TCTACAAGGCCCTGAGCGACCACCACGTCTACCTGGAGGGTACTCTGCTG
AAGCCCAACATGGTCACCGCCGGTCAGTCGGCCAAGAAGAACACCCCCGA
GGAGATCGCCCTGGCCACCGTGCAGGCTCTGCGCCGCACCGTTCCCGCCG
CCGTTACTGGCGTGACCTTCCTGTCTGGAGGTCAGTCCGAGGAGGAGGCC
ACCGTCAACCTGAGTGCCATCAACAACGTTCCCTTGATCCGCCCATGGGC
CCTCACCTTCTCGTACGGTCGTGCCCTGCAGGCCTCCGTCCTGCGTGCCT
GGGCTGGCAAGAAGGAGAACATTGCTGCCGGCCAGAACGAGCTGCTTAAG
CGCGCCAAGGCCAACGGTGATGCTGCTCAGGGCAAGTACGTTGCCGGCAG
CGCTGGTGCCGGATCTGGATCCCTGTTCGTGGCCAACCACGCCTACTAAG
GCGTTTGGTTGGACCTTGGCTACACGTTACTACAAAAAAAAAAAATACGA
AGCAGATTGCTGGAAAAGTTTGGCAGATTTGTTTATTTTTACCTTAGTTT
CGAGAGCTAAGCAAAGCAAGCATTACAAAAAATAACCAAAAAAAAAAAAA
AAAAA

LD37852.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:17:47
Subject Length Description Subject Range Query Range Score Percent Strand
Aldolase-RB 2375 Aldolase-RB 285..1782 1..1498 7490 100 Plus
Aldolase.l 2375 Aldolase.l 285..1782 1..1498 7490 100 Plus
Aldolase.m 2909 Aldolase.m 285..1782 1..1498 7490 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:29:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 22080278..22081096 1060..242 4050 99.6 Minus
chr3R 27901430 chr3R 22084392..22084633 242..1 1210 100 Minus
chr3R 27901430 chr3R 22078257..22078487 1487..1258 1105 99.6 Minus
chr3R 27901430 chr3R 22079986..22080191 1260..1055 1000 99 Minus
chr3R 27901430 chr3R 22237241..22237860 345..964 505 72.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:32:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:29:12
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 26257224..26258042 1060..242 4095 100 Minus
3R 32079331 3R 26261336..26261577 242..1 1210 100 Minus
3R 32079331 3R 26255193..26255433 1498..1258 1205 100 Minus
3R 32079331 3R 26256932..26257137 1260..1055 1015 99.5 Minus
3R 32079331 3R 26414213..26414832 345..964 505 72.1 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:41:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 25998055..25998873 1060..242 4095 100 Minus
3R 31820162 3R 26002167..26002408 242..1 1210 100 Minus
3R 31820162 3R 25996024..25996264 1498..1258 1205 100 Minus
3R 31820162 3R 25997763..25997968 1260..1055 1015 99.5 Minus
3R 31820162 3R 26155305..26155424 606..725 315 84.1 Plus
3R 31820162 3R 26155044..26155132 345..433 160 78.6 Plus
Blast to na_te.dros performed on 2019-03-15 22:29:12 has no hits.

LD37852.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:30:09 Download gff for LD37852.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 22078257..22078485 1260..1487 99 <- Minus
chr3R 22079987..22080186 1060..1259 99 <- Minus
chr3R 22080279..22081095 243..1059 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:20:08 Download gff for LD37852.complete
Subject Subject Range Query Range Percent Splice Strand
Ald-RD 1..1086 264..1349 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:00:09 Download gff for LD37852.complete
Subject Subject Range Query Range Percent Splice Strand
Ald-RD 1..1086 264..1349 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:21:49 Download gff for LD37852.complete
Subject Subject Range Query Range Percent Splice Strand
Ald-RD 1..1086 264..1349 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:30:33 Download gff for LD37852.complete
Subject Subject Range Query Range Percent Splice Strand
Ald-RD 1..1086 264..1349 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:24:38 Download gff for LD37852.complete
Subject Subject Range Query Range Percent Splice Strand
Ald-RD 1..1086 264..1349 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:47:30 Download gff for LD37852.complete
Subject Subject Range Query Range Percent Splice Strand
Ald-RB 15..1501 1..1487 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:00:09 Download gff for LD37852.complete
Subject Subject Range Query Range Percent Splice Strand
Ald-RB 15..1501 1..1487 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:21:49 Download gff for LD37852.complete
Subject Subject Range Query Range Percent Splice Strand
Ald-RB 15..1501 1..1487 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:30:33 Download gff for LD37852.complete
Subject Subject Range Query Range Percent Splice Strand
Ald-RB 15..1501 1..1487 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:24:38 Download gff for LD37852.complete
Subject Subject Range Query Range Percent Splice Strand
Ald-RB 15..1501 1..1487 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:30:09 Download gff for LD37852.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26255204..26255431 1260..1487 100 <- Minus
3R 26256933..26257132 1060..1259 100 <- Minus
3R 26257225..26258041 243..1059 100 <- Minus
3R 26261336..26261577 1..242 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:30:09 Download gff for LD37852.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26255204..26255431 1260..1487 100 <- Minus
3R 26256933..26257132 1060..1259 100 <- Minus
3R 26257225..26258041 243..1059 100 <- Minus
3R 26261336..26261577 1..242 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:30:09 Download gff for LD37852.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26255204..26255431 1260..1487 100 <- Minus
3R 26256933..26257132 1060..1259 100 <- Minus
3R 26257225..26258041 243..1059 100 <- Minus
3R 26261336..26261577 1..242 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:21:49 Download gff for LD37852.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 22080926..22081153 1260..1487 100 <- Minus
arm_3R 22082655..22082854 1060..1259 100 <- Minus
arm_3R 22082947..22083763 243..1059 100 <- Minus
arm_3R 22087058..22087299 1..242 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:06:59 Download gff for LD37852.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25996035..25996262 1260..1487 100 <- Minus
3R 25997764..25997963 1060..1259 100 <- Minus
3R 25998056..25998872 243..1059 100 <- Minus
3R 26002167..26002408 1..242 100   Minus

LD37852.pep Sequence

Translation from 263 to 1348

> LD37852.pep
MTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVE
NTEDNRRAYRQLLFSTDPKLAENISGVILFHETLYQKADDGTPFAEILKK
KGIILGIKVDKGVVPLFGSEDEVTTQGLDDLAARCAQYKKDGCDFAKWRC
VLKIGKNTPSYQSILENANVLARYASICQSQRIVPIVEPEVLPDGDHDLD
RAQKVTETVLAAVYKALSDHHVYLEGTLLKPNMVTAGQSAKKNTPEEIAL
ATVQALRRTVPAAVTGVTFLSGGQSEEEATVNLSAINNVPLIRPWALTFS
YGRALQASVLRAWAGKKENIAAGQNELLKRAKANGDAAQGKYVAGSAGAG
SGSLFVANHAY*

LD37852.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 10:37:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16038-PA 363 GF16038-PA 1..363 1..361 1714 90.4 Plus
Dana\GF20732-PA 364 GF20732-PA 1..354 1..353 1375 70.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 10:37:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12193-PA 363 GG12193-PA 1..363 1..361 1818 95 Plus
Dere\GG11473-PA 364 GG11473-PA 1..354 1..353 1359 69.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 10:38:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18178-PA 363 GH18178-PA 1..363 1..361 1627 85.7 Plus
Dgri\GH19415-PA 364 GH19415-PA 1..353 1..352 1380 72.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:06:55
Subject Length Description Subject Range Query Range Score Percent Strand
Ald-PM 361 CG6058-PM 1..361 1..361 1838 100 Plus
Ald-PK 361 CG6058-PK 1..361 1..361 1838 100 Plus
Ald-PD 361 CG6058-PD 1..361 1..361 1838 100 Plus
Ald-PC 361 CG6058-PC 1..361 1..361 1838 100 Plus
Ald-PB 361 CG6058-PB 1..361 1..361 1838 100 Plus
Ald-PJ 363 CG6058-PJ 1..363 1..361 1761 96.1 Plus
Ald-PL 363 CG6058-PL 1..363 1..361 1761 96.1 Plus
Ald-PH 363 CG6058-PH 1..363 1..361 1761 96.1 Plus
Ald-PI 363 CG6058-PI 1..363 1..361 1755 95.9 Plus
Ald-PE 363 CG6058-PE 1..363 1..361 1755 95.9 Plus
CG5432-PB 364 CG5432-PB 1..354 1..353 1285 69.8 Plus
CG5432-PA 364 CG5432-PA 1..354 1..353 1285 69.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 10:38:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10131-PA 361 GI10131-PA 1..361 1..361 1650 88.4 Plus
Dmoj\GI22619-PA 364 GI22619-PA 1..353 1..352 1375 71.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 10:38:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21844-PA 364 GL21844-PA 1..354 1..353 1321 68.1 Plus
Dper\GL22000-PA 319 GL22000-PA 1..178 1..177 759 84.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:38:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19329-PC 361 GA19329-PC 1..361 1..361 1803 93.9 Plus
Dpse\GA19329-PB 363 GA19329-PB 1..363 1..361 1748 91.7 Plus
Dpse\GA19329-PD 363 GA19329-PD 1..363 1..361 1721 90.6 Plus
Dpse\GA18877-PA 364 GA18877-PA 1..354 1..353 1325 68.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 10:38:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10189-PA 363 GM10189-PA 1..363 1..361 1837 95.9 Plus
Dsec\GM10318-PA 364 GM10318-PA 1..354 1..353 1355 69.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 10:38:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18141-PA 363 GD18141-PA 1..363 1..361 1831 95.6 Plus
Dsim\GD21278-PA 354 GD21278-PA 1..344 1..353 1274 67.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 10:38:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23350-PA 363 GJ23350-PA 1..363 1..361 1626 84.6 Plus
Dvir\GJ23865-PA 364 GJ23865-PA 1..362 1..361 1434 71.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 10:38:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13316-PA 386 GK13316-PA 1..386 1..361 1731 88.9 Plus
Dwil\GK13312-PA 364 GK13312-PA 1..347 1..346 1400 71.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 10:38:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10635-PA 363 GE10635-PA 1..363 1..361 1829 95.3 Plus
Dyak\GE23665-PA 364 GE23665-PA 1..354 1..353 1360 69.5 Plus

LD37852.hyp Sequence

Translation from 263 to 1348

> LD37852.hyp
MTTYFNYPSKELQDELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVE
NTEDNRRAYRQLLFSTDPKLAENISGVILFHETLYQKADDGTPFAEILKK
KGIILGIKVDKGVVPLFGSEDEVTTQGLDDLAARCAQYKKDGCDFAKWRC
VLKIGKNTPSYQSILENANVLARYASICQSQRIVPIVEPEVLPDGDHDLD
RAQKVTETVLAAVYKALSDHHVYLEGTLLKPNMVTAGQSAKKNTPEEIAL
ATVQALRRTVPAAVTGVTFLSGGQSEEEATVNLSAINNVPLIRPWALTFS
YGRALQASVLRAWAGKKENIAAGQNELLKRAKANGDAAQGKYVAGSAGAG
SGSLFVANHAY*

LD37852.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:25:50
Subject Length Description Subject Range Query Range Score Percent Strand
Ald-PM 361 CG6058-PM 1..361 1..361 1838 100 Plus
Ald-PK 361 CG6058-PK 1..361 1..361 1838 100 Plus
Ald-PD 361 CG6058-PD 1..361 1..361 1838 100 Plus
Ald-PC 361 CG6058-PC 1..361 1..361 1838 100 Plus
Ald-PB 361 CG6058-PB 1..361 1..361 1838 100 Plus