Clone LD37859 Report

Search the DGRC for LD37859

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:378
Well:59
Vector:pOT2
Associated Gene/TranscriptRpS27-RA
Protein status:LD37859.pep: gold
Preliminary Size:715
Sequenced Size:733

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10423 2002-01-01 Sim4 clustering to Release 2
CG10423 2002-05-18 Blastp of sequenced clone
RpS27 2008-04-29 Release 5.5 accounting
RpS27 2008-08-15 Release 5.9 accounting
RpS27 2008-12-18 5.12 accounting

Clone Sequence Records

LD37859.complete Sequence

733 bp (733 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118959

> LD37859.complete
CAAGTTAAGTTGGCTGCGATTTACCCCACTTCCTTTTCCGTGTTAGCTGT
GAAAGAAAAAACATGCCGCTAGCAAAAGATCTTCTGCACCCTCTGCCCGC
CGAGGAGAAGCGCAAGCACAAGCTGAAGCGCCTGGTCCAGCACCCCAACT
CGTACTTCATGGACGTGAAGTGCCCCGGCTGCTACAGGATCACCACCGTC
TTCAGCCACGCCCAAGGCGTCGTGGTCTGCGCTGGATGCGCTACCATTTT
GTGCCAGCCGACTGGAGGACGCGCCAAGCTGACAGAAGGCTGCTCCTTCC
GCAGGAAGCCACAGTAAAATGGGACTCGCGATGAACCACAAATTATTAAT
TTTTTAATAAAAACTCTAAAACGTAAAGAAACCACAGAACCCATACGAGA
GAAAGCTTGTAATTCAATTGCTGCGGTCCTTTGGTTCATTGTGCTTTGTG
AATTAAAGAATTAACGATGTTGTGGTCGGCTAAGTGAAAAAAAAAACAGT
TCTTGTCGTATTTGTTTATAGAAAGTGGATAATTGCCAACAGGATAGATA
GTGGAGCTCAATCGCTGGGGTTCCCCGATAAGAAACCGCCCATAATGGAA
GCTCTTGTGTGTGCAAATACCCTTGTGCGGCAAAACTTCAGGAATTTTTC
ACTAGTTATGCTTAGATCTAACCATTGATTAACTTCACAACAATAAAGAA
TGTTTCATAGGCTCTAAAAAAAAAAAAAAAAAA

LD37859.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:02:54
Subject Length Description Subject Range Query Range Score Percent Strand
RpS27-RA 980 RpS27-RA 113..830 1..718 3590 100 Plus
RpS27.a 703 RpS27.a 288..703 303..718 2080 100 Plus
RpS27.a 703 RpS27.a 2..290 1..289 1445 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:31:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 21069039..21069467 715..287 2145 100 Minus
chr3R 27901430 chr3R 21069531..21069756 289..64 1115 99.6 Minus
chr3R 27901430 chr3R 21070517..21070584 68..1 340 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:32:36 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:31:53
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25245952..25246383 718..287 2160 100 Minus
3R 32079331 3R 25246447..25246672 289..64 1115 99.6 Minus
3R 32079331 3R 25247433..25247500 68..1 340 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:34:31
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 24986783..24987214 718..287 2160 100 Minus
3R 31820162 3R 24987278..24987503 289..64 1115 99.5 Minus
3R 31820162 3R 24988264..24988331 68..1 340 100 Minus
Blast to na_te.dros performed on 2019-03-15 18:31:53 has no hits.

LD37859.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:33:00 Download gff for LD37859.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 21069532..21069751 69..288 100 <- Minus
chr3R 21070517..21070584 1..68 100   Minus
chr3R 21069039..21069465 289..715 94 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:20:11 Download gff for LD37859.complete
Subject Subject Range Query Range Percent Splice Strand
RpS27-RA 1..255 63..317 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:44:07 Download gff for LD37859.complete
Subject Subject Range Query Range Percent Splice Strand
RpS27-RB 1..255 63..317 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:06:57 Download gff for LD37859.complete
Subject Subject Range Query Range Percent Splice Strand
RpS27-RA 1..255 63..317 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:36:18 Download gff for LD37859.complete
Subject Subject Range Query Range Percent Splice Strand
RpS27-RA 1..255 63..317 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:05:52 Download gff for LD37859.complete
Subject Subject Range Query Range Percent Splice Strand
RpS27-RA 1..255 63..317 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:19:01 Download gff for LD37859.complete
Subject Subject Range Query Range Percent Splice Strand
RpS27-RA 1..715 1..715 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:44:07 Download gff for LD37859.complete
Subject Subject Range Query Range Percent Splice Strand
RpS27-RA 15..729 1..715 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:06:57 Download gff for LD37859.complete
Subject Subject Range Query Range Percent Splice Strand
RpS27-RA 15..729 1..715 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:36:18 Download gff for LD37859.complete
Subject Subject Range Query Range Percent Splice Strand
RpS27-RA 1..715 1..715 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:05:52 Download gff for LD37859.complete
Subject Subject Range Query Range Percent Splice Strand
RpS27-RA 15..729 1..715 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:33:00 Download gff for LD37859.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25246448..25246667 69..288 100 <- Minus
3R 25247433..25247500 1..68 100   Minus
3R 25245955..25246381 289..715 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:33:00 Download gff for LD37859.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25246448..25246667 69..288 100 <- Minus
3R 25247433..25247500 1..68 100   Minus
3R 25245955..25246381 289..715 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:33:00 Download gff for LD37859.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25246448..25246667 69..288 100 <- Minus
3R 25247433..25247500 1..68 100   Minus
3R 25245955..25246381 289..715 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:06:57 Download gff for LD37859.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21072170..21072389 69..288 100 <- Minus
arm_3R 21073155..21073222 1..68 100   Minus
arm_3R 21071677..21072103 289..715 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:08:41 Download gff for LD37859.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24986786..24987212 289..715 100 <- Minus
3R 24987279..24987498 69..288 100 <- Minus
3R 24988264..24988331 1..68 100   Minus

LD37859.hyp Sequence

Translation from 62 to 316

> LD37859.hyp
MPLAKDLLHPLPAEEKRKHKLKRLVQHPNSYFMDVKCPGCYRITTVFSHA
QGVVVCAGCATILCQPTGGRAKLTEGCSFRRKPQ*

LD37859.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:02:55
Subject Length Description Subject Range Query Range Score Percent Strand
RpS27-PB 84 CG10423-PB 1..84 1..84 461 100 Plus
RpS27-PA 84 CG10423-PA 1..84 1..84 461 100 Plus

LD37859.pep Sequence

Translation from 62 to 316

> LD37859.pep
MPLAKDLLHPLPAEEKRKHKLKRLVQHPNSYFMDVKCPGCYRITTVFSHA
QGVVVCAGCATILCQPTGGRAKLTEGCSFRRKPQ*

LD37859.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:12:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17433-PA 84 GF17433-PA 1..84 1..84 444 100 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:12:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12272-PA 84 GG12272-PA 1..84 1..84 444 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:12:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19510-PA 84 GH19510-PA 1..84 1..84 444 100 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:34:22
Subject Length Description Subject Range Query Range Score Percent Strand
RpS27-PB 84 CG10423-PB 1..84 1..84 461 100 Plus
RpS27-PA 84 CG10423-PA 1..84 1..84 461 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:12:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22987-PA 84 GI22987-PA 1..84 1..84 444 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:12:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12615-PA 84 GL12615-PA 1..84 1..84 444 100 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:12:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10310-PA 91 GA10310-PA 1..84 1..84 445 100 Plus
Dpse\GA27572-PA 84 GA27572-PA 1..84 1..84 444 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:12:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17738-PA 84 GM17738-PA 1..84 1..84 444 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:12:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18221-PA 84 GD18221-PA 1..84 1..84 444 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:12:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24684-PA 84 GJ24684-PA 1..84 1..84 444 100 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:12:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14300-PA 84 GK14300-PA 1..84 1..84 444 100 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:12:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10722-PA 84 GE10722-PA 1..84 1..84 444 100 Plus