Clone LD37882 Report

Search the DGRC for LD37882

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:378
Well:82
Vector:pOT2
Associated Gene/TranscriptCG42496-RA
Protein status:LD37882.pep2: gold LD37882.pep: gold
Preliminary Size:1187
Sequenced Size:1074

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17950 2002-01-01 Sim4 clustering to Release 2
CG30290 2002-05-04 Blastp of sequenced clone
CG30290 2003-01-01 Sim4 clustering to Release 3
CG30290 2008-04-29 Release 5.5 accounting
CG30290 2008-08-15 Release 5.9 accounting
CG30290 2008-12-18 5.12 accounting

Clone Sequence Records

LD37882.complete Sequence

1074 bp (1074 high quality bases) assembled on 2002-05-04

GenBank Submission: AY102691.1

> LD37882.complete
CAACATTCTCTGGTCACACTGACTTGCTGTTTACACAATTATTTCGTAAT
TTTAAGTCATATTTTATCAATGAATTAAGATAAGGAGCGAGCAGAGCAAC
TCACAAATGACTTCGCAGATCTACAGCCAGAAGAAGTTCGTGCCCACGCC
GCCCGAGAAGGGTTCCTTTCCCCTGGACCACGAAGGTCTCTGCAAGAAGC
AATTCCTCCTCTACGCCAGTTGTCTGCGCAAGAACGCCCAGGATACGAGC
CAGTGCCGCCAGGACGCCCAGAACTACCTGGCCTGTCGCATGGACAACAA
TCTTATGGAGAAAACCGAGTGGTCCAAGTTGGGCTTTCACGACCAGAGTA
CCAAGACCGATCAAAAAGAACCGGAGGTGCAGAAGCAATAGCCGGCATTG
TGAGCCATGAAACCCGAACGTAATGTGATGATAGCGGCCACCGGAAGTGT
GGCCACCATTAAGTTAGCCCAGTTAATCCGAGAGCTCTCCGACGAGCGCC
TACCCTTTAAGTTCCACCTGAAAGTACTTATTACCGAAGCAGCCAAACAC
TTCTTTGAACTGGAGCAGATTCCCGAAAATGTACCCATTTACCACAATCG
CGACGAGTGGATCACCTGGAACAAGCGAGGAGATCCTGTACTCCACATAG
ATCTAGGCAAGTGGGCGGATTTGTTGGTAATAGCCCCACTCAGCGCAAAC
TCTCTGTCCAAAATGGCCACCGGGATTTGCGATAATATCGTCATGTGTGT
GGTGCGGGCCTGGGACCTTGAGAAGCCGCTGCTCTTTGCACCTGCGATGA
ATACCCGTATGTACGACCATCCAATAACTCGGGAGCAGATCGACAAGCTG
ACCAGTTGGGGCTACAAGGAGATACCCTGCATATCCAAGACTCTGATGTG
CGGTGATACTGGCAACGGCGCCATGGCGGAGGTACCCACAATTGTGGAAG
CGGTGTTATCCGCCTTTCAGCCGATTAAATAGTTATGCACACAAAGTTTA
TATCGCAGAATATTTTGTTACAATAGTTAGACAAATAATATGGAATTGGC
TATGAAAAAAAAAAAAAAAAAAAA

LD37882.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:09:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG42496-RA 1054 CG42496-RA 1..1054 1..1054 5270 100 Plus
Ppcdc-RA 1054 Ppcdc-RA 1..1054 1..1054 5270 100 Plus
CG17922-RA 3377 CG17922-RA 3296..3377 1057..976 410 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:16:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 17578075..17578655 1..581 2800 98.8 Plus
chr2R 21145070 chr2R 17578917..17579249 722..1054 1635 99.4 Plus
chr2R 21145070 chr2R 17578718..17578859 581..722 680 98.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:32:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:16:25
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21691590..21692170 1..581 2905 100 Plus
2R 25286936 2R 21692432..21692767 722..1057 1680 100 Plus
2R 25286936 2R 21692234..21692375 581..722 710 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:40:08
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 21692789..21693369 1..581 2905 100 Plus
2R 25260384 2R 21693631..21693966 722..1057 1680 100 Plus
2R 25260384 2R 21693433..21693574 581..722 710 100 Plus
Blast to na_te.dros performed 2019-03-16 11:16:26
Subject Length Description Subject Range Query Range Score Percent Strand
TART-A 13424 TART-A 13424bp 13031..13078 95..46 110 72 Minus

LD37882.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:17:20 Download gff for LD37882.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 17578075..17578655 1..581 98 -> Plus
chr2R 17578719..17578858 582..721 98 -> Plus
chr2R 17578917..17579249 722..1054 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:20:13 Download gff for LD37882.complete
Subject Subject Range Query Range Percent Splice Strand
CG30290-RA 1..576 407..982 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:53:08 Download gff for LD37882.complete
Subject Subject Range Query Range Percent Splice Strand
Ppcdc-RA 1..576 407..982 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:37:57 Download gff for LD37882.complete
Subject Subject Range Query Range Percent Splice Strand
Ppcdc-RA 1..576 407..982 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:45:39 Download gff for LD37882.complete
Subject Subject Range Query Range Percent Splice Strand
CG30290-RA 1..576 407..982 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:10:02 Download gff for LD37882.complete
Subject Subject Range Query Range Percent Splice Strand
Ppcdc-RA 1..576 407..982 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:31:28 Download gff for LD37882.complete
Subject Subject Range Query Range Percent Splice Strand
CG30290-RA 1..1054 1..1054 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:53:08 Download gff for LD37882.complete
Subject Subject Range Query Range Percent Splice Strand
CG42496-RA 1..1054 1..1054 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:37:57 Download gff for LD37882.complete
Subject Subject Range Query Range Percent Splice Strand
Ppcdc-RA 11..1064 1..1054 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:45:39 Download gff for LD37882.complete
Subject Subject Range Query Range Percent Splice Strand
CG30290-RA 1..1054 1..1054 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:10:02 Download gff for LD37882.complete
Subject Subject Range Query Range Percent Splice Strand
Ppcdc-RA 11..1064 1..1054 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:17:20 Download gff for LD37882.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21691590..21692170 1..581 100 -> Plus
2R 21692235..21692374 582..721 100 -> Plus
2R 21692432..21692764 722..1054 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:17:20 Download gff for LD37882.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21691590..21692170 1..581 100 -> Plus
2R 21692235..21692374 582..721 100 -> Plus
2R 21692432..21692764 722..1054 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:17:20 Download gff for LD37882.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21691590..21692170 1..581 100 -> Plus
2R 21692235..21692374 582..721 100 -> Plus
2R 21692432..21692764 722..1054 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:37:57 Download gff for LD37882.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17579095..17579675 1..581 100 -> Plus
arm_2R 17579740..17579879 582..721 100 -> Plus
arm_2R 17579937..17580269 722..1054 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:18:09 Download gff for LD37882.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21692789..21693369 1..581 100 -> Plus
2R 21693434..21693573 582..721 100 -> Plus
2R 21693631..21693963 722..1054 100   Plus

LD37882.pep2 Sequence

Translation from 106 to 390

> LD37882.pep2
MTSQIYSQKKFVPTPPEKGSFPLDHEGLCKKQFLLYASCLRKNAQDTSQC
RQDAQNYLACRMDNNLMEKTEWSKLGFHDQSTKTDQKEPEVQKQ*

LD37882.pep2 Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 12:16:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13263-PA 93 GF13263-PA 1..81 1..81 420 92.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 12:16:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22133-PA 94 GG22133-PA 1..94 1..94 487 95.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:15:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG42496-PB 94 CG42496-PB 1..94 1..94 509 100 Plus
CG42496-PA 94 CG42496-PA 1..94 1..94 509 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 12:16:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16945-PA 89 GL16945-PA 1..80 1..80 425 95 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 12:16:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24997-PA 89 GA24997-PA 1..80 1..80 425 95 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 12:16:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15857-PA 94 GM15857-PA 1..94 1..94 498 98.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 12:16:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16924-PA 94 GD16924-PA 1..94 1..94 498 98.9 Plus
Dsim\GD11619-PA 94 GD11619-PA 1..94 1..94 498 98.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 12:16:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21565-PA 270 GJ21565-PA 1..55 1..55 246 78.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 12:16:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12215-PA 94 GE12215-PA 1..94 1..94 494 97.9 Plus

LD37882.hyp Sequence

Translation from 406 to 981

> LD37882.hyp
MKPERNVMIAATGSVATIKLAQLIRELSDERLPFKFHLKVLITEAAKHFF
ELEQIPENVPIYHNRDEWITWNKRGDPVLHIDLGKWADLLVIAPLSANSL
SKMATGICDNIVMCVVRAWDLEKPLLFAPAMNTRMYDHPITREQIDKLTS
WGYKEIPCISKTLMCGDTGNGAMAEVPTIVEAVLSAFQPIK*

LD37882.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:50:54
Subject Length Description Subject Range Query Range Score Percent Strand
Ppcdc-PB 191 CG30290-PB 1..191 1..191 1005 100 Plus
Ppcdc-PA 191 CG30290-PA 1..191 1..191 1005 100 Plus

LD37882.pep Sequence

Translation from 406 to 981

> LD37882.pep
MKPERNVMIAATGSVATIKLAQLIRELSDERLPFKFHLKVLITEAAKHFF
ELEQIPENVPIYHNRDEWITWNKRGDPVLHIDLGKWADLLVIAPLSANSL
SKMATGICDNIVMCVVRAWDLEKPLLFAPAMNTRMYDHPITREQIDKLTS
WGYKEIPCISKTLMCGDTGNGAMAEVPTIVEAVLSAFQPIK*

LD37882.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:11:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13264-PA 191 GF13264-PA 1..188 1..188 935 89.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:11:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22134-PA 191 GG22134-PA 1..189 1..189 1000 98.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:11:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22990-PA 192 GH22990-PA 1..187 1..187 822 78.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:58:47
Subject Length Description Subject Range Query Range Score Percent Strand
Ppcdc-PB 191 CG30290-PB 1..191 1..191 1005 100 Plus
Ppcdc-PA 191 CG30290-PA 1..191 1..191 1005 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:11:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18958-PA 191 GI18958-PA 1..187 1..187 850 80.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:11:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16946-PA 191 GL16946-PA 1..188 1..188 919 88.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:11:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15754-PA 191 GA15754-PA 1..188 1..188 922 89.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:11:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15858-PA 191 GM15858-PA 1..191 1..191 1002 97.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:11:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11620-PA 191 GD11620-PA 1..191 1..191 1000 97.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:11:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21565-PA 270 GJ21565-PA 80..267 1..188 881 83.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:11:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15923-PA 194 GK15923-PA 1..188 1..188 903 87.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:11:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12216-PA 191 GE12216-PA 1..189 1..189 998 97.9 Plus