Clone LD38087 Report

Search the DGRC for LD38087

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:380
Well:87
Vector:pOT2
Associated Gene/Transcriptjagn-RA
Protein status:LD38087.pep: gold
Preliminary Size:1327
Sequenced Size:1122

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10978 2001-01-01 Release 2 assignment
CG10978 2001-10-10 Blastp of sequenced clone
CG10978 2003-01-01 Sim4 clustering to Release 3
jagn 2008-04-29 Release 5.5 accounting
jagn 2008-08-15 Release 5.9 accounting
jagn 2008-12-18 5.12 accounting

Clone Sequence Records

LD38087.complete Sequence

1122 bp (1122 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061443

> LD38087.complete
ATGGTATCGCACACACATCGATTCTAGTGCCAGCCCTATTTTTTGTGCAA
TTATTTATTAAAAATAAGCAACGACGTGAGCGAACGACACGACCCACGAA
CGAAGGCAACGAAATGGCAACGCGCGGCGGACCAATGGTCGCGGGCACCG
ATGGCAACGACTTCGAGTTCAGGCAGCGCGTAGCTGGCACATATCAAATT
AGCCTGCTGAACAAGTCCAGGTTGAAGTACTGCATCTTCTTTCACGCCCT
GCTGTTCTTCGTGATGCTGGCCAAGCTGACGTCGGACATTCTGGACCACC
TGGATATCTTTGTGCTGGAGATCGAGGAGCTGGAGGTCCCACCGCCCCTG
TGGTGGGAGTACGTGTGGGCCGCGTCGTTGCTCACCTCCTTCCTGGGCCT
TTCGGCCGCCAGGGGCAACAAGGTGCGCGAAATGCAGAAGTATATGGTGG
CCATACTGCTATTCGCCATCCTGCCACTCTTCTACTGCTTCGCCTACTAC
TTCTCGGACGTGTGGGAGTTCGCCACGCTGGACAAGTCGGTGGAGCTGGA
CGAGACAGACATCTTTGTGTGGCGCGGTTATCCGTACGGCGTCTTCTGGT
ATGCCTTCTGCTTTGTGGGCTTCCAGGTGCACGGATTTACGCTGTACTTC
GCCTACAACCTGGTCAAGGCCTGGAAGGCCAGAACTGCCACGCGCAAGTT
CCAGTAATCTAAATACTCGCCAAACTAGTAAACGCCGGAATGCAGGGCTA
GTTGTAAATAATTTGGAAACTTGAAACTAACTCAAAACACTAGTGCACAA
AAGCGTAATGAAACTATGGTAAACTAAAGTTATGCAGCTGTTAAGGTATC
GCACACTTAGTCATACAGGAAGGGAAACATATGGTCGAAACTGAGCGAAG
CGTCGGCGGTAAGGTTATTGTTAGTTGAAAGTTAGTTGATACCGTTTTCA
AATTGATTAAATAGACTCTTATCCATATACACATGTACACCTATACACAT
AGACATACATATATACACACATACGCAGCCTTGTGAGGTCAACTAAAGAC
AAGAAGCAACTGAAGCCACCAAATTTCCCCGAGTCGGAATAAAAACTGAA
AACCAAAAAAAAAAAAAAAAAA

LD38087.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:14:53
Subject Length Description Subject Range Query Range Score Percent Strand
jagn-RA 1741 jagn-RA 33..1138 1..1106 5530 100 Plus
jagn-RB 1741 jagn-RB 33..1138 1..1106 5530 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:59:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 1605882..1606410 576..1104 2645 100 Plus
chr3R 27901430 chr3R 1605443..1605820 199..576 1890 100 Plus
chr3R 27901430 chr3R 1604962..1605163 1..202 1010 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:32:50 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:59:19
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5780235..5780765 576..1106 2655 100 Plus
3R 32079331 3R 5779796..5780173 199..576 1890 100 Plus
3R 32079331 3R 5779315..5779516 1..202 1010 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:38:33
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 5521066..5521596 576..1106 2655 100 Plus
3R 31820162 3R 5520627..5521004 199..576 1890 100 Plus
3R 31820162 3R 5520146..5520347 1..202 1010 100 Plus
Blast to na_te.dros performed 2019-03-16 19:59:19
Subject Length Description Subject Range Query Range Score Percent Strand
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 1073..1107 67..34 118 85.7 Minus

LD38087.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:00:16 Download gff for LD38087.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 1604962..1605163 1..202 100 -> Plus
chr3R 1605447..1605819 203..575 100 -> Plus
chr3R 1605882..1606410 576..1104 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:20:25 Download gff for LD38087.complete
Subject Subject Range Query Range Percent Splice Strand
jagn-RA 1..594 114..707 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:55:58 Download gff for LD38087.complete
Subject Subject Range Query Range Percent Splice Strand
jagn-RA 1..594 114..707 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:37:09 Download gff for LD38087.complete
Subject Subject Range Query Range Percent Splice Strand
jagn-RB 1..594 114..707 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:25:07 Download gff for LD38087.complete
Subject Subject Range Query Range Percent Splice Strand
jagn-RA 1..594 114..707 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:48:46 Download gff for LD38087.complete
Subject Subject Range Query Range Percent Splice Strand
jagn-RB 1..594 114..707 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:41:53 Download gff for LD38087.complete
Subject Subject Range Query Range Percent Splice Strand
jagn-RA 7..1110 1..1104 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:55:58 Download gff for LD38087.complete
Subject Subject Range Query Range Percent Splice Strand
jagn-RB 7..1110 1..1104 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:37:09 Download gff for LD38087.complete
Subject Subject Range Query Range Percent Splice Strand
jagn-RB 1..1104 1..1104 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:25:08 Download gff for LD38087.complete
Subject Subject Range Query Range Percent Splice Strand
jagn-RA 7..1110 1..1104 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:48:46 Download gff for LD38087.complete
Subject Subject Range Query Range Percent Splice Strand
jagn-RB 1..1104 1..1104 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:00:16 Download gff for LD38087.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5779315..5779516 1..202 100 -> Plus
3R 5779800..5780172 203..575 100 -> Plus
3R 5780235..5780763 576..1104 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:00:16 Download gff for LD38087.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5779315..5779516 1..202 100 -> Plus
3R 5779800..5780172 203..575 100 -> Plus
3R 5780235..5780763 576..1104 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:00:16 Download gff for LD38087.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5779315..5779516 1..202 100 -> Plus
3R 5779800..5780172 203..575 100 -> Plus
3R 5780235..5780763 576..1104 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:37:09 Download gff for LD38087.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1605037..1605238 1..202 100 -> Plus
arm_3R 1605522..1605894 203..575 100 -> Plus
arm_3R 1605957..1606485 576..1104 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:02:18 Download gff for LD38087.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5520146..5520347 1..202 100 -> Plus
3R 5520631..5521003 203..575 100 -> Plus
3R 5521066..5521594 576..1104 100   Plus

LD38087.hyp Sequence

Translation from 2 to 706

> LD38087.hyp
GIAHTSILVPALFFVQLFIKNKQRRERTTRPTNEGNEMATRGGPMVAGTD
GNDFEFRQRVAGTYQISLLNKSRLKYCIFFHALLFFVMLAKLTSDILDHL
DIFVLEIEELEVPPPLWWEYVWAASLLTSFLGLSAARGNKVREMQKYMVA
ILLFAILPLFYCFAYYFSDVWEFATLDKSVELDETDIFVWRGYPYGVFWY
AFCFVGFQVHGFTLYFAYNLVKAWKARTATRKFQ*

LD38087.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:37:09
Subject Length Description Subject Range Query Range Score Percent Strand
jagn-PA 197 CG10978-PA 1..197 38..234 1056 100 Plus
jagn-PB 197 CG10978-PB 1..197 38..234 1056 100 Plus

LD38087.pep Sequence

Translation from 113 to 706

> LD38087.pep
MATRGGPMVAGTDGNDFEFRQRVAGTYQISLLNKSRLKYCIFFHALLFFV
MLAKLTSDILDHLDIFVLEIEELEVPPPLWWEYVWAASLLTSFLGLSAAR
GNKVREMQKYMVAILLFAILPLFYCFAYYFSDVWEFATLDKSVELDETDI
FVWRGYPYGVFWYAFCFVGFQVHGFTLYFAYNLVKAWKARTATRKFQ*

LD38087.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 10:00:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16348-PA 197 GF16348-PA 1..197 1..197 1017 95.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 10:00:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13023-PA 197 GG13023-PA 1..197 1..197 1034 99 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 10:00:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18154-PA 196 GH18154-PA 1..196 1..197 934 86.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:52
Subject Length Description Subject Range Query Range Score Percent Strand
jagn-PA 197 CG10978-PA 1..197 1..197 1056 100 Plus
jagn-PB 197 CG10978-PB 1..197 1..197 1056 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 10:00:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10107-PA 197 GI10107-PA 1..197 1..197 964 89.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 10:00:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24521-PA 197 GL24521-PA 1..197 1..197 1008 95.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:00:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10683-PA 197 GA10683-PA 1..197 1..197 1008 95.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 10:00:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10838-PA 197 GM10838-PA 1..197 1..197 1033 99 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 10:00:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19818-PA 197 GD19818-PA 1..197 1..197 1036 99.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 10:00:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23328-PA 197 GJ23328-PA 1..197 1..197 977 90.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 10:00:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13429-PA 197 GK13429-PA 1..197 1..197 988 92.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 10:00:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10162-PA 197 GE10162-PA 1..197 1..197 1019 97.5 Plus