BDGP Sequence Production Resources |
Search the DGRC for LD38087
Library: | LD |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Ling Hong |
Date Registered: | 1997-12-04 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 380 |
Well: | 87 |
Vector: | pOT2 |
Associated Gene/Transcript | jagn-RA |
Protein status: | LD38087.pep: gold |
Preliminary Size: | 1327 |
Sequenced Size: | 1122 |
Gene | Date | Evidence |
---|---|---|
CG10978 | 2001-01-01 | Release 2 assignment |
CG10978 | 2001-10-10 | Blastp of sequenced clone |
CG10978 | 2003-01-01 | Sim4 clustering to Release 3 |
jagn | 2008-04-29 | Release 5.5 accounting |
jagn | 2008-08-15 | Release 5.9 accounting |
jagn | 2008-12-18 | 5.12 accounting |
1122 bp (1122 high quality bases) assembled on 2001-10-10
GenBank Submission: AY061443
> LD38087.complete ATGGTATCGCACACACATCGATTCTAGTGCCAGCCCTATTTTTTGTGCAA TTATTTATTAAAAATAAGCAACGACGTGAGCGAACGACACGACCCACGAA CGAAGGCAACGAAATGGCAACGCGCGGCGGACCAATGGTCGCGGGCACCG ATGGCAACGACTTCGAGTTCAGGCAGCGCGTAGCTGGCACATATCAAATT AGCCTGCTGAACAAGTCCAGGTTGAAGTACTGCATCTTCTTTCACGCCCT GCTGTTCTTCGTGATGCTGGCCAAGCTGACGTCGGACATTCTGGACCACC TGGATATCTTTGTGCTGGAGATCGAGGAGCTGGAGGTCCCACCGCCCCTG TGGTGGGAGTACGTGTGGGCCGCGTCGTTGCTCACCTCCTTCCTGGGCCT TTCGGCCGCCAGGGGCAACAAGGTGCGCGAAATGCAGAAGTATATGGTGG CCATACTGCTATTCGCCATCCTGCCACTCTTCTACTGCTTCGCCTACTAC TTCTCGGACGTGTGGGAGTTCGCCACGCTGGACAAGTCGGTGGAGCTGGA CGAGACAGACATCTTTGTGTGGCGCGGTTATCCGTACGGCGTCTTCTGGT ATGCCTTCTGCTTTGTGGGCTTCCAGGTGCACGGATTTACGCTGTACTTC GCCTACAACCTGGTCAAGGCCTGGAAGGCCAGAACTGCCACGCGCAAGTT CCAGTAATCTAAATACTCGCCAAACTAGTAAACGCCGGAATGCAGGGCTA GTTGTAAATAATTTGGAAACTTGAAACTAACTCAAAACACTAGTGCACAA AAGCGTAATGAAACTATGGTAAACTAAAGTTATGCAGCTGTTAAGGTATC GCACACTTAGTCATACAGGAAGGGAAACATATGGTCGAAACTGAGCGAAG CGTCGGCGGTAAGGTTATTGTTAGTTGAAAGTTAGTTGATACCGTTTTCA AATTGATTAAATAGACTCTTATCCATATACACATGTACACCTATACACAT AGACATACATATATACACACATACGCAGCCTTGTGAGGTCAACTAAAGAC AAGAAGCAACTGAAGCCACCAAATTTCCCCGAGTCGGAATAAAAACTGAA AACCAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 1605882..1606410 | 576..1104 | 2645 | 100 | Plus |
chr3R | 27901430 | chr3R | 1605443..1605820 | 199..576 | 1890 | 100 | Plus |
chr3R | 27901430 | chr3R | 1604962..1605163 | 1..202 | 1010 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Max-element | 8556 | Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). | 1073..1107 | 67..34 | 118 | 85.7 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 1604962..1605163 | 1..202 | 100 | -> | Plus |
chr3R | 1605447..1605819 | 203..575 | 100 | -> | Plus |
chr3R | 1605882..1606410 | 576..1104 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
jagn-RA | 1..594 | 114..707 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
jagn-RA | 1..594 | 114..707 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
jagn-RB | 1..594 | 114..707 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
jagn-RA | 1..594 | 114..707 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
jagn-RB | 1..594 | 114..707 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
jagn-RA | 7..1110 | 1..1104 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
jagn-RB | 7..1110 | 1..1104 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
jagn-RB | 1..1104 | 1..1104 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
jagn-RA | 7..1110 | 1..1104 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
jagn-RB | 1..1104 | 1..1104 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 5779315..5779516 | 1..202 | 100 | -> | Plus |
3R | 5779800..5780172 | 203..575 | 100 | -> | Plus |
3R | 5780235..5780763 | 576..1104 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 5779315..5779516 | 1..202 | 100 | -> | Plus |
3R | 5779800..5780172 | 203..575 | 100 | -> | Plus |
3R | 5780235..5780763 | 576..1104 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 5779315..5779516 | 1..202 | 100 | -> | Plus |
3R | 5779800..5780172 | 203..575 | 100 | -> | Plus |
3R | 5780235..5780763 | 576..1104 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 1605037..1605238 | 1..202 | 100 | -> | Plus |
arm_3R | 1605522..1605894 | 203..575 | 100 | -> | Plus |
arm_3R | 1605957..1606485 | 576..1104 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 5520146..5520347 | 1..202 | 100 | -> | Plus |
3R | 5520631..5521003 | 203..575 | 100 | -> | Plus |
3R | 5521066..5521594 | 576..1104 | 100 | Plus |
Translation from 2 to 706
> LD38087.hyp GIAHTSILVPALFFVQLFIKNKQRRERTTRPTNEGNEMATRGGPMVAGTD GNDFEFRQRVAGTYQISLLNKSRLKYCIFFHALLFFVMLAKLTSDILDHL DIFVLEIEELEVPPPLWWEYVWAASLLTSFLGLSAARGNKVREMQKYMVA ILLFAILPLFYCFAYYFSDVWEFATLDKSVELDETDIFVWRGYPYGVFWY AFCFVGFQVHGFTLYFAYNLVKAWKARTATRKFQ*
Translation from 113 to 706
> LD38087.pep MATRGGPMVAGTDGNDFEFRQRVAGTYQISLLNKSRLKYCIFFHALLFFV MLAKLTSDILDHLDIFVLEIEELEVPPPLWWEYVWAASLLTSFLGLSAAR GNKVREMQKYMVAILLFAILPLFYCFAYYFSDVWEFATLDKSVELDETDI FVWRGYPYGVFWYAFCFVGFQVHGFTLYFAYNLVKAWKARTATRKFQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF16348-PA | 197 | GF16348-PA | 1..197 | 1..197 | 1017 | 95.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG13023-PA | 197 | GG13023-PA | 1..197 | 1..197 | 1034 | 99 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18154-PA | 196 | GH18154-PA | 1..196 | 1..197 | 934 | 86.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
jagn-PA | 197 | CG10978-PA | 1..197 | 1..197 | 1056 | 100 | Plus |
jagn-PB | 197 | CG10978-PB | 1..197 | 1..197 | 1056 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI10107-PA | 197 | GI10107-PA | 1..197 | 1..197 | 964 | 89.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24521-PA | 197 | GL24521-PA | 1..197 | 1..197 | 1008 | 95.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA10683-PA | 197 | GA10683-PA | 1..197 | 1..197 | 1008 | 95.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM10838-PA | 197 | GM10838-PA | 1..197 | 1..197 | 1033 | 99 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD19818-PA | 197 | GD19818-PA | 1..197 | 1..197 | 1036 | 99.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23328-PA | 197 | GJ23328-PA | 1..197 | 1..197 | 977 | 90.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK13429-PA | 197 | GK13429-PA | 1..197 | 1..197 | 988 | 92.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE10162-PA | 197 | GE10162-PA | 1..197 | 1..197 | 1019 | 97.5 | Plus |