Clone LD38104 Report

Search the DGRC for LD38104

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:381
Well:4
Vector:pOT2
Associated Gene/TranscriptRrp47-RA
Protein status:LD38104.pep: gold
Preliminary Size:1000
Sequenced Size:811

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8928-RA 2009-01-21 est gleaning
CG8928 2009-06-08 Manual selection by Joe Carlson

Clone Sequence Records

LD38104.complete Sequence

811 bp assembled on 2009-07-30

GenBank Submission: BT089004.1

> LD38104.complete
CCAGATATAAACATTCGCACGCGATTTTAATTCCATTTAAAGAACATGGC
TCAAGAAAATCAAGCTGTCGACAATGGACTGCCCTGCAACGCTTACCTGG
ACACAAGCCTGCGAGAGGACGAAAACATGCAACACATCCTGAAAACCTTT
TACAGCAGCATCGAACTCCTGGAAGCCGACACGGAGAAGGCACTGGCGCT
ACAGGCAGAACGCACATTGAACACAAATGAACAAATAAAATTGGATAGCT
ACCTTGTGTACTTGAACAGCACACTGTTTTTCATATACCTGAAACTGCAG
GGTGAAGATGCCTCAAATCATGCTGTGATGCACGATTTGCGTCGTACAAG
GGACCTACTTGCCCGCGATAAGAAAATAAACGATGCTCTAGCGGCGCCAA
GACTGGATATGCCCGCTGCCAAGCGATTTATCGCAGCTGGAACCCACACA
CGATTTGTGGACATGAACGGAGTTATGGTCTCCGAAAAACAATATAATAA
AAGCAAGCAAGAAACTCCCAAATAATTAAAATCACAAAGTGTTGATTCTA
TAGTATAGCAGCCTAAAAGGATCATTTGCCTTTGTTTCGTCGTTACGCTA
GACAATGACAGTTGTATTAAAAAATGTATAGAAAACACGATATTTTCTTA
CTGAACCATCCAAAACACAAGCGTCACAAGCAATCGACTCATCAAAGAAG
TCAAGTTAGTACACCTTAATGAAACTGGGTTTACAAACTGAAACTGTTTG
TTTTTTAAATGAATATCAACAACGTTCTGTATATGAATAAACTAATCTAG
GTAAAAATGAA

LD38104.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:27:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG8928.b 1239 CG8928.b 115..925 1..811 4055 100 Plus
CG8928-RA 959 CG8928-RA 115..925 1..811 4055 100 Plus
CG8928.a 838 CG8928.a 70..838 43..811 3845 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:48:20
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 15835259..15835749 319..809 2455 100 Plus
chrX 22417052 chrX 15834873..15835190 1..318 1590 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:32:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:48:17
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15945397..15945889 319..811 2465 100 Plus
X 23542271 X 15945011..15945328 1..318 1590 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:21:39
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 15953495..15953987 319..811 2465 100 Plus
X 23527363 X 15953109..15953426 1..318 1590 100 Plus
Blast to na_te.dros performed on 2019-03-15 18:48:18 has no hits.

LD38104.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:49:15 Download gff for LD38104.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 15834873..15835190 1..318 100 -> Plus
chrX 15835259..15835751 319..811 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:12:19 Download gff for LD38104.complete
Subject Subject Range Query Range Percent Splice Strand
CG8928-RA 1..480 46..525 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:53:11 Download gff for LD38104.complete
Subject Subject Range Query Range Percent Splice Strand
CG8928-RA 1..480 46..525 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:32:04 Download gff for LD38104.complete
Subject Subject Range Query Range Percent Splice Strand
Rrp47-RA 1..480 46..525 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:01:30 Download gff for LD38104.complete
Subject Subject Range Query Range Percent Splice Strand
Rrp47-RA 1..480 46..525 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-07-30 15:36:09 Download gff for LD38104.complete
Subject Subject Range Query Range Percent Splice Strand
CG8928-RA 1..809 1..809 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:53:11 Download gff for LD38104.complete
Subject Subject Range Query Range Percent Splice Strand
CG8928-RA 1..809 1..809 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:32:04 Download gff for LD38104.complete
Subject Subject Range Query Range Percent Splice Strand
Rrp47-RA 34..842 1..809 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:01:30 Download gff for LD38104.complete
Subject Subject Range Query Range Percent Splice Strand
Rrp47-RA 34..842 1..809 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:49:15 Download gff for LD38104.complete
Subject Subject Range Query Range Percent Splice Strand
X 15945011..15945328 1..318 100 -> Plus
X 15945397..15945889 319..811 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:49:15 Download gff for LD38104.complete
Subject Subject Range Query Range Percent Splice Strand
X 15945011..15945328 1..318 100 -> Plus
X 15945397..15945889 319..811 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:49:15 Download gff for LD38104.complete
Subject Subject Range Query Range Percent Splice Strand
X 15945011..15945328 1..318 100 -> Plus
X 15945397..15945889 319..811 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:32:04 Download gff for LD38104.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 15839044..15839361 1..318 100 -> Plus
arm_X 15839430..15839922 319..811 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:44:04 Download gff for LD38104.complete
Subject Subject Range Query Range Percent Splice Strand
X 15953109..15953426 1..318 100 -> Plus
X 15953495..15953987 319..811 100   Plus

LD38104.hyp Sequence

Translation from 45 to 524

> LD38104.hyp
MAQENQAVDNGLPCNAYLDTSLREDENMQHILKTFYSSIELLEADTEKAL
ALQAERTLNTNEQIKLDSYLVYLNSTLFFIYLKLQGEDASNHAVMHDLRR
TRDLLARDKKINDALAAPRLDMPAAKRFIAAGTHTRFVDMNGVMVSEKQY
NKSKQETPK*

LD38104.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:50:21
Subject Length Description Subject Range Query Range Score Percent Strand
Rrp47-PB 159 CG8928-PB 1..159 1..159 806 100 Plus
Rrp47-PA 159 CG8928-PA 1..159 1..159 806 100 Plus

LD38104.pep Sequence

Translation from 45 to 524

> LD38104.pep
MAQENQAVDNGLPCNAYLDTSLREDENMQHILKTFYSSIELLEADTEKAL
ALQAERTLNTNEQIKLDSYLVYLNSTLFFIYLKLQGEDASNHAVMHDLRR
TRDLLARDKKINDALAAPRLDMPAAKRFIAAGTHTRFVDMNGVMVSEKQY
NKSKQETPK*

LD38104.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:22:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19713-PA 154 GF19713-PA 6..131 17..142 402 59.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:22:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17933-PA 159 GG17933-PA 1..159 1..159 685 81.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:22:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12544-PA 151 GH12544-PA 16..146 25..156 362 52.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:28:11
Subject Length Description Subject Range Query Range Score Percent Strand
Rrp47-PB 159 CG8928-PB 1..159 1..159 806 100 Plus
Rrp47-PA 159 CG8928-PA 1..159 1..159 806 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:22:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14174-PA 103 GI14174-PA 22..103 25..105 138 42.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:22:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25611-PA 164 GA25611-PA 17..153 17..153 401 53.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:22:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22601-PA 159 GM22601-PA 1..159 1..159 753 88.7 Plus
Dsec\GM22554-PA 158 GM22554-PA 1..158 1..159 725 86.8 Plus
Dsec\GM26682-PA 134 GM26682-PA 1..134 25..159 608 86.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:22:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17253-PA 159 GD17253-PA 1..159 1..159 755 88.7 Plus
Dsim\GD17220-PA 169 GD17220-PA 1..158 1..158 741 88 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:22:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18423-PA 90 GJ18423-PA 17..88 14..90 165 44.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:22:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15287-PA 161 GK15287-PA 16..155 18..157 430 54.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:22:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17240-PA 160 GE17240-PA 1..159 1..159 705 84.3 Plus