Clone LD38634 Report

Search the DGRC for LD38634

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:386
Well:34
Vector:pOT2
Associated Gene/TranscriptCG11035-RA
Protein status:LD38634.pep: gold
Preliminary Size:985
Sequenced Size:834

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11035 2001-01-01 Release 2 assignment
CG11035 2001-10-10 Blastp of sequenced clone
CG11035 2003-01-01 Sim4 clustering to Release 3
CG11035 2008-04-29 Release 5.5 accounting
CG11035 2008-08-15 Release 5.9 accounting
CG11035 2008-12-18 5.12 accounting

Clone Sequence Records

LD38634.complete Sequence

834 bp (834 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061449

> LD38634.complete
CCAAAACAAGTGAAGCGGGCGAAAGAACACATCCAAGATGTACCAGCACA
GCCCAATGTTGTGGCGACCTCTGCTTCTGCTGCGTGGCCTCTACCTCAGT
CAACGCCACCAGATGAGCCACTACGACGCACTGGGAATCAGGCGTCAGTG
CACGCAGAACGAGATCAAGGCAGCTTACTATAAGCTCTCGATGCTTTATC
ATCCGGACAGGAACCAAGGAAGTGAGAACGCAGCCAAGAAATTTCGGGAG
ATCAATCAGGCTTATGAGATTCTGGGAAATTACCGGCTGCGTCGACTTTA
CGACAAGGGAATCGTACATACGGCAGGCGCCCAATATGCCCAAGATGTCC
ACGATGTAGCGGAACCCGTAGTCGAGGACGATGCGGAGACTAAGTTTTAC
AAGTCGCGATTTCAGAAATCGCGTGTATCTGATTCTGCGGGCCGTACGCC
CATCTATGACTTCGACGAGTGGTCGCGAAATCACTATGGTAAATCATTTG
ACCGGAGACAAGCCGCCCAGGCCAAATACGATCGAATAAAAGTGCAAAGG
GAGACCAACAGAATATCAGGCCAGACTGACATGGTCCTGCTGGCCTTTAT
CTTTGCCGGAGTGGCCGTATACCTGATGTTCCTCGCCGAAAGCTCCTACG
ACACTCCCAAGCAGAAAGCGAAGGAACGATACAGACGCGATCAAGAAGAG
CGAGAACAAAAACTAGTCGGGAAGCAATCTTAGAATTCTCTAGTCTTCAG
CGTACATAGACTTAAGTTAAATGAATTAAATTCGAAACAATATAATTTTG
TGAATTAAAAAAAAAAAAAAAAAAAAAAAAAAAA

LD38634.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:11:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG11035-RA 809 CG11035-RA 4..809 1..806 4030 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:39:17
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 3858215..3859017 803..1 3940 99.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:33:23 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:39:15
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8032136..8032944 809..1 4045 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:35:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 7772967..7773775 809..1 4045 100 Minus
Blast to na_te.dros performed on 2019-03-16 16:39:15 has no hits.

LD38634.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:39:59 Download gff for LD38634.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 3858212..3859017 1..806 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:20:54 Download gff for LD38634.complete
Subject Subject Range Query Range Percent Splice Strand
CG11035-RA 1..696 38..733 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:50:30 Download gff for LD38634.complete
Subject Subject Range Query Range Percent Splice Strand
CG11035-RA 1..696 38..733 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:21:55 Download gff for LD38634.complete
Subject Subject Range Query Range Percent Splice Strand
CG11035-RA 1..696 38..733 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:19:35 Download gff for LD38634.complete
Subject Subject Range Query Range Percent Splice Strand
CG11035-RA 1..696 38..733 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:37:31 Download gff for LD38634.complete
Subject Subject Range Query Range Percent Splice Strand
CG11035-RA 1..696 38..733 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:35:11 Download gff for LD38634.complete
Subject Subject Range Query Range Percent Splice Strand
CG11035-RA 4..809 1..806 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:50:30 Download gff for LD38634.complete
Subject Subject Range Query Range Percent Splice Strand
CG11035-RA 4..809 1..806 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:21:55 Download gff for LD38634.complete
Subject Subject Range Query Range Percent Splice Strand
CG11035-RA 66..871 1..806 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:19:35 Download gff for LD38634.complete
Subject Subject Range Query Range Percent Splice Strand
CG11035-RA 4..809 1..806 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:37:31 Download gff for LD38634.complete
Subject Subject Range Query Range Percent Splice Strand
CG11035-RA 66..871 1..806 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:39:59 Download gff for LD38634.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8032139..8032944 1..806 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:39:59 Download gff for LD38634.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8032139..8032944 1..806 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:39:59 Download gff for LD38634.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8032139..8032944 1..806 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:21:55 Download gff for LD38634.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 3857861..3858666 1..806 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:56:17 Download gff for LD38634.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7772970..7773775 1..806 100   Minus

LD38634.pep Sequence

Translation from 37 to 732

> LD38634.pep
MYQHSPMLWRPLLLLRGLYLSQRHQMSHYDALGIRRQCTQNEIKAAYYKL
SMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLYDKGIVHTAGAQY
AQDVHDVAEPVVEDDAETKFYKSRFQKSRVSDSAGRTPIYDFDEWSRNHY
GKSFDRRQAAQAKYDRIKVQRETNRISGQTDMVLLAFIFAGVAVYLMFLA
ESSYDTPKQKAKERYRRDQEEREQKLVGKQS*

LD38634.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:21:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16867-PA 228 GF16867-PA 1..228 1..230 911 74.3 Plus
Dana\GF17599-PA 403 GF17599-PA 4..67 25..91 156 43.3 Plus
Dana\GF15175-PA 346 GF15175-PA 5..66 28..90 153 46 Plus
Dana\GF10972-PA 250 GF10972-PA 17..79 27..89 150 42.9 Plus
Dana\GF12761-PA 351 GF12761-PA 2..66 26..89 150 43.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:21:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24719-PA 231 GG24719-PA 1..231 1..231 1090 90 Plus
Dere\GG23080-PA 874 GG23080-PA 32..128 29..125 158 38.6 Plus
Dere\GG19654-PA 403 GG19654-PA 4..97 25..125 157 36.5 Plus
Dere\GG24779-PA 350 GG24779-PA 5..66 28..90 154 46 Plus
Dere\GG22292-PA 353 GG22292-PA 2..66 26..89 153 44.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:21:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15145-PA 231 GH15145-PA 1..221 1..221 856 72.2 Plus
Dgri\GH11404-PA 346 GH11404-PA 5..66 28..90 157 46 Plus
Dgri\GH21307-PA 504 GH21307-PA 66..138 18..89 155 41.1 Plus
Dgri\GH16687-PA 262 GH16687-PA 17..80 27..90 147 42.2 Plus
Dgri\GH16902-PA 127 GH16902-PA 5..84 28..110 141 36.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:51:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG11035-PB 231 CG11035-PB 1..231 1..231 1206 100 Plus
CG11035-PA 231 CG11035-PA 1..231 1..231 1206 100 Plus
mrj-PG 346 CG8448-PG 2..122 26..157 166 30.8 Plus
mrj-PH 346 CG8448-PH 2..122 26..157 166 30.8 Plus
mrj-PE 346 CG8448-PE 2..122 26..157 166 30.8 Plus
Droj2-PE 403 CG8863-PE 4..67 25..91 157 43.3 Plus
Droj2-PD 403 CG8863-PD 4..67 25..91 157 43.3 Plus
Droj2-PC 403 CG8863-PC 4..67 25..91 157 43.3 Plus
Droj2-PB 403 CG8863-PB 4..67 25..91 157 43.3 Plus
Droj2-PA 403 CG8863-PA 4..67 25..91 157 43.3 Plus
CG5001-PC 346 CG5001-PC 5..66 28..90 154 46 Plus
CG5001-PD 350 CG5001-PD 5..66 28..90 154 46 Plus
CG5001-PA 350 CG5001-PA 5..66 28..90 154 46 Plus
CG5001-PB 350 CG5001-PB 5..66 28..90 154 46 Plus
mrj-PA 259 CG8448-PA 2..67 26..90 153 40.9 Plus
mrj-PC 259 CG8448-PC 2..67 26..90 153 40.9 Plus
mrj-PB 259 CG8448-PB 2..67 26..90 153 40.9 Plus
mrj-PD 259 CG8448-PD 2..67 26..90 153 40.9 Plus
l(2)tid-PE 445 CG5504-PE 66..127 28..89 152 41.9 Plus
l(2)tid-PA 447 CG5504-PA 66..127 28..89 152 41.9 Plus
l(2)tid-PC 507 CG5504-PC 66..127 28..89 152 41.9 Plus
l(2)tid-PD 514 CG5504-PD 66..127 28..89 152 41.9 Plus
l(2)tid-PB 520 CG5504-PB 66..127 28..89 152 41.9 Plus
Csp-PA 223 CG6395-PA 17..79 27..89 149 42.9 Plus
Csp-PC 228 CG6395-PC 17..79 27..89 149 42.9 Plus
Csp-PE 244 CG6395-PE 17..79 27..89 149 42.9 Plus
Csp-PD 244 CG6395-PD 17..79 27..89 149 42.9 Plus
Csp-PF 249 CG6395-PF 17..79 27..89 149 42.9 Plus
Csp-PB 249 CG6395-PB 17..79 27..89 149 42.9 Plus
CG7133-PA 353 CG7133-PA 8..66 28..89 149 46.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:21:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22491-PA 233 GI22491-PA 1..222 1..221 828 70.5 Plus
Dmoj\GI14539-PA 347 GI14539-PA 5..66 28..90 160 47.6 Plus
Dmoj\GI24337-PA 404 GI24337-PA 4..67 25..91 156 43.3 Plus
Dmoj\GI17261-PA 499 GI17261-PA 388..498 20..143 153 32.6 Plus
Dmoj\GI11373-PA 249 GI11373-PA 16..78 27..89 151 42.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:21:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22336-PA 230 GL22336-PA 1..218 1..220 933 78.7 Plus
Dper\GL24472-PA 404 GL24472-PA 4..67 25..91 156 43.3 Plus
Dper\GL15626-PA 318 GL15626-PA 5..66 28..90 153 46 Plus
Dper\GL10681-PA 357 GL10681-PA 2..66 26..89 147 43.1 Plus
Dper\GL20793-PA 158 GL20793-PA 17..79 27..89 143 41.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:21:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10720-PA 230 GA10720-PA 1..218 1..220 936 79.2 Plus
Dpse\GA21376-PA 404 GA21376-PA 4..67 25..91 156 43.3 Plus
Dpse\GA18584-PA 346 GA18584-PA 5..66 28..90 153 46 Plus
Dpse\GA24322-PA 525 GA24322-PA 71..146 15..89 150 39.5 Plus
Dpse\GA21086-PA 357 GA21086-PA 2..66 26..89 147 43.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:21:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10434-PA 231 GM10434-PA 1..231 1..231 1208 97 Plus
Dsec\GM24106-PA 382 GM24106-PA 4..67 25..91 157 43.3 Plus
Dsec\GM16806-PA 350 GM16806-PA 5..66 28..90 153 46 Plus
Dsec\DnaJ-1-PA 337 GM13903-PA 6..80 29..103 151 43.4 Plus
Dsec\GM22437-PA 249 GM22437-PA 17..80 27..90 148 42.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:21:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19434-PA 231 GD19434-PA 1..231 1..231 1200 96.1 Plus
Dsim\GD18906-PA 403 GD18906-PA 4..67 25..91 157 43.3 Plus
Dsim\GD23083-PA 346 GD23083-PA 5..66 28..90 153 46 Plus
Dsim\DnaJ-1-PA 352 GD13179-PA 6..66 29..90 150 46.8 Plus
Dsim\GD17653-PA 189 GD17653-PA 18..81 27..90 146 42.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:21:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10092-PA 231 GJ10092-PA 24..220 25..222 813 73.2 Plus
Dvir\GJ16971-PA 347 GJ16971-PA 5..66 28..90 156 46 Plus
Dvir\GJ10422-PA 403 GJ10422-PA 4..67 25..91 156 43.3 Plus
Dvir\l(2)tid-PA 516 GJ18004-PA 68..142 16..89 154 41.3 Plus
Dvir\GJ11627-PA 245 GJ11627-PA 17..80 27..90 151 42.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:21:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13822-PA 226 GK13822-PA 1..220 1..219 843 71 Plus
Dwil\GK13941-PA 403 GK13941-PA 4..67 25..91 157 43.3 Plus
Dwil\GK15183-PA 346 GK15183-PA 5..66 28..90 153 46 Plus
Dwil\GK17894-PA 352 GK17894-PA 2..66 26..89 150 44.6 Plus
Dwil\GK17108-PA 253 GK17108-PA 17..79 27..89 149 42.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:21:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25746-PA 231 GE25746-PA 1..231 1..231 1059 90 Plus
Dyak\GE26270-PA 403 GE26270-PA 4..67 25..91 155 43.3 Plus
Dyak\GE17451-PA 350 GE17451-PA 5..66 28..90 154 46 Plus
Dyak\GE14089-PA 351 GE14089-PA 2..66 26..89 152 44.6 Plus
Dyak\DnaJ-1-PA 351 GE20542-PA 6..92 29..125 151 35.1 Plus

LD38634.hyp Sequence

Translation from 37 to 732

> LD38634.hyp
MYQHSPMLWRPLLLLRGLYLSQRHQMSHYDALGIRRQCTQNEIKAAYYKL
SMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLYDKGIVHTAGAQY
AQDVHDVAEPVVEDDAETKFYKSRFQKSRVSDSAGRTPIYDFDEWSRNHY
GKSFDRRQAAQAKYDRIKVQRETNRISGQTDMVLLAFIFAGVAVYLMFLA
ESSYDTPKQKAKERYRRDQEEREQKLVGKQS*

LD38634.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:35:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG11035-PA 231 CG11035-PA 1..231 1..231 1206 100 Plus
mrj-PG 346 CG8448-PG 2..122 26..157 166 30.8 Plus
mrj-PH 346 CG8448-PH 2..122 26..157 166 30.8 Plus
mrj-PE 346 CG8448-PE 2..122 26..157 166 30.8 Plus
Droj2-PE 403 CG8863-PE 4..67 25..91 157 43.3 Plus