Clone LD38670 Report

Search the DGRC for LD38670

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:386
Well:70
Vector:pOT2
Associated Gene/TranscriptCG4645-RA
Protein status:LD38670.pep: gold
Preliminary Size:1561
Sequenced Size:1369

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4645 2001-01-01 Release 2 assignment
CG4645 2001-09-19 Blastp of sequenced clone
CG4645 2003-01-01 Sim4 clustering to Release 3
CG4645 2008-04-29 Release 5.5 accounting
CG4645 2008-08-15 Release 5.9 accounting
CG4645 2008-12-18 5.12 accounting

Clone Sequence Records

LD38670.complete Sequence

1369 bp (1369 high quality bases) assembled on 2001-09-19

GenBank Submission: AY058677

> LD38670.complete
ATTTTTTTGGGCCAAGTGCAAAATACGTGTAATATTTACAATTAGCAAAA
CGAAACCAATCTAGTCGAGCCGAAATCTAAATGGAGACACCCATGGCCGA
TGACCTGTTGCAGTTCCGCGACTACAGCGGCGGTGCCCCGGCCCAAATCA
ATGTCAATTCCCCTACGCACGGCGGATCGGGTGGTTCTGGTGGTGGCTCT
GCTGGTTCCGGCGGCTCCGTTGGCGGTGGTGGTGCCAACGCACAGCGTCA
ACGCGGCGATCCGCTGGCGGATCTCATCTATGACATGACCTCCTCGGCCC
AGGGATTCTCCGGAGCTGCATCCTCGGGCGGCTCCCAGCCGCAGAACTCA
TCGCTGGACGGATCCGCCGGCGGTGGAGGCGGTGGTGCGAAACTATCACT
GTTTACGATCGAGTACTACCAGCAGTTCTTCAACGTGGACACCTATATGG
TGCTCGAGCGAATCGCCAACTCCATGATACCCAAACGGGCCTCTGGCAAC
TATCTGCGCATGAACATCGGCGAGAATCCGGATCTATATGGACCCTTCTG
GATAACCGTCACCCTGATCTTTTCCATAGCAATAAGTGGTAATATTGCCA
GCTATTTGCAGCAAGCCACTGATGCGTACAAATGGCACTACAACTTCCAT
CTGGTCTCCTATGCGGCTACGTCCATCTTCTTGTATGCCAATATCTTGCC
AGCCGTTCTGTGGGCCCTCTTCAAGTACAGCCTGAAGCCTGTGGACTCCG
CTGATGCCGTGGAAACGGACAGCGCCAGCTACATGCCGAGCCTCTTGTCG
CTGATGTGCATCTATGGATACAGTTTGGCCATTTATATACCAGTCTCCAT
TCTCTGGGTGATCAATATCTCTCTGCTGCAGTGGCTCCTGGTGATCACCG
CCGCCTTGCTTTCGGGCACGGTTTTGATTGCGGTGCTAACGCCAGCGCTG
CGCAACTCGCAATTCTCGCTGTTCCTCATCGTTGGAATCCTGAGTGCACA
TGTGGTGCTGGCCGCCGGATTTCTGCTCTATTTCTTTCACAATCCCACAG
TCCCGTCGCTGGATCCAGTTGCTCCGACACCAGCTGCACCTGCTGCTCCG
GCTGCTCTGAAAGCCGTGACGCAGGCGGTTGTCAACGCAGTGCCCGGCAA
TCAGACCCACTAGGATGCATTCCGCGAGAAACCAGTTCGTCAACGTCGCT
GAACTAAGCTGTAAATTAAGTTGTCCCTATTTTTATATTCGCTAGAGAGC
TGATCACGTTGGTTCCAGCTTCGTGGTTTGTATTCACTTTCAATAACTTT
TTCGCGACTGTATATTCATATTATCTTAAAGGTAGATGTACGTGTAATAC
CAAAAAAAAAAAAAAAAAA

LD38670.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:17:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG4645-RA 1697 CG4645-RA 171..1537 1..1367 6820 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:21:55
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 12801046..12801611 1..566 2830 100 Plus
chrX 22417052 chrX 12802336..12802820 867..1351 2425 100 Plus
chrX 22417052 chrX 12801675..12801883 566..774 1045 100 Plus
chrX 22417052 chrX 12801947..12802039 774..866 450 98.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:33:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:21:54
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 12910123..12910688 1..566 2830 100 Plus
X 23542271 X 12911413..12911913 867..1367 2490 99.8 Plus
X 23542271 X 12910752..12910960 566..774 1045 100 Plus
X 23542271 X 12911024..12911116 774..866 465 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:40:59
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 12918221..12918786 1..566 2830 100 Plus
X 23527363 X 12919511..12920011 867..1367 2490 99.8 Plus
X 23527363 X 12918850..12919058 566..774 1045 100 Plus
X 23527363 X 12919122..12919214 774..866 465 100 Plus
Blast to na_te.dros performed 2019-03-16 04:21:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\Tom 7060 Dana\Tom DNTOMRETA 7060bp Derived from Z24451 (Rel. 44, Last updated, Version 6). 4804..4847 8..51 112 72.7 Plus

LD38670.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:22:58 Download gff for LD38670.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 12801947..12802039 774..866 98 -> Plus
chrX 12801046..12801611 1..566 100 -> Plus
chrX 12801676..12801882 567..773 100 -> Plus
chrX 12802336..12802820 867..1351 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:20:56 Download gff for LD38670.complete
Subject Subject Range Query Range Percent Splice Strand
CG4645-RA 1..1083 81..1163 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:00:01 Download gff for LD38670.complete
Subject Subject Range Query Range Percent Splice Strand
CG4645-RA 1..1083 81..1163 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:26:49 Download gff for LD38670.complete
Subject Subject Range Query Range Percent Splice Strand
CG4645-RA 1..1083 81..1163 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:30:26 Download gff for LD38670.complete
Subject Subject Range Query Range Percent Splice Strand
CG4645-RA 1..1083 81..1163 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:36:30 Download gff for LD38670.complete
Subject Subject Range Query Range Percent Splice Strand
CG4645-RA 1..1083 81..1163 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:47:20 Download gff for LD38670.complete
Subject Subject Range Query Range Percent Splice Strand
CG4645-RA 171..1521 1..1351 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:00:01 Download gff for LD38670.complete
Subject Subject Range Query Range Percent Splice Strand
CG4645-RA 171..1521 1..1351 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:26:49 Download gff for LD38670.complete
Subject Subject Range Query Range Percent Splice Strand
CG4645-RA 171..1521 1..1351 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:30:26 Download gff for LD38670.complete
Subject Subject Range Query Range Percent Splice Strand
CG4645-RA 171..1521 1..1351 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:36:30 Download gff for LD38670.complete
Subject Subject Range Query Range Percent Splice Strand
CG4645-RA 171..1521 1..1351 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:22:58 Download gff for LD38670.complete
Subject Subject Range Query Range Percent Splice Strand
X 12910123..12910688 1..566 100 -> Plus
X 12910753..12910959 567..773 100 -> Plus
X 12911024..12911116 774..866 100 -> Plus
X 12911413..12911897 867..1351 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:22:58 Download gff for LD38670.complete
Subject Subject Range Query Range Percent Splice Strand
X 12910123..12910688 1..566 100 -> Plus
X 12910753..12910959 567..773 100 -> Plus
X 12911024..12911116 774..866 100 -> Plus
X 12911413..12911897 867..1351 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:22:58 Download gff for LD38670.complete
Subject Subject Range Query Range Percent Splice Strand
X 12910123..12910688 1..566 100 -> Plus
X 12910753..12910959 567..773 100 -> Plus
X 12911024..12911116 774..866 100 -> Plus
X 12911413..12911897 867..1351 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:26:49 Download gff for LD38670.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 12805057..12805149 774..866 100 -> Plus
arm_X 12804786..12804992 567..773 100 -> Plus
arm_X 12804156..12804721 1..566 100 -> Plus
arm_X 12805446..12805930 867..1351 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:06:51 Download gff for LD38670.complete
Subject Subject Range Query Range Percent Splice Strand
X 12918221..12918786 1..566 100 -> Plus
X 12918851..12919057 567..773 100 -> Plus
X 12919122..12919214 774..866 100 -> Plus
X 12919511..12919995 867..1351 100   Plus

LD38670.pep Sequence

Translation from 80 to 1162

> LD38670.pep
METPMADDLLQFRDYSGGAPAQINVNSPTHGGSGGSGGGSAGSGGSVGGG
GANAQRQRGDPLADLIYDMTSSAQGFSGAASSGGSQPQNSSLDGSAGGGG
GGAKLSLFTIEYYQQFFNVDTYMVLERIANSMIPKRASGNYLRMNIGENP
DLYGPFWITVTLIFSIAISGNIASYLQQATDAYKWHYNFHLVSYAATSIF
LYANILPAVLWALFKYSLKPVDSADAVETDSASYMPSLLSLMCIYGYSLA
IYIPVSILWVINISLLQWLLVITAALLSGTVLIAVLTPALRNSQFSLFLI
VGILSAHVVLAAGFLLYFFHNPTVPSLDPVAPTPAAPAAPAALKAVTQAV
VNAVPGNQTH*

LD38670.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 10:38:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21391-PA 356 GF21391-PA 1..356 1..360 1351 81.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 10:38:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17742-PA 361 GG17742-PA 1..361 1..360 1532 92.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 10:38:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24422-PA 350 GH24422-PA 1..344 1..355 1248 73.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:09:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG4645-PB 360 CG4645-PB 1..360 1..360 1845 100 Plus
CG4645-PC 360 CG4645-PC 1..360 1..360 1845 100 Plus
CG4645-PA 360 CG4645-PA 1..360 1..360 1845 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 10:38:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16281-PA 365 GI16281-PA 1..364 1..359 1269 75 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 10:38:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22972-PA 178 GL22972-PA 17..178 197..360 655 79.9 Plus
Dper\GL22971-PA 127 GL22971-PA 1..127 1..123 303 60.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:38:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18325-PA 362 GA18325-PA 1..362 1..360 1352 75.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 10:38:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11589-PA 356 GM11589-PA 1..356 1..360 1775 96.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 10:38:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16517-PA 350 GJ16517-PA 1..349 1..359 1253 73.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 10:38:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25646-PA 362 GK25646-PA 1..362 1..360 1282 74.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 10:38:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17032-PA 358 GE17032-PA 1..358 1..360 1522 91.5 Plus

LD38670.hyp Sequence

Translation from 80 to 1162

> LD38670.hyp
METPMADDLLQFRDYSGGAPAQINVNSPTHGGSGGSGGGSAGSGGSVGGG
GANAQRQRGDPLADLIYDMTSSAQGFSGAASSGGSQPQNSSLDGSAGGGG
GGAKLSLFTIEYYQQFFNVDTYMVLERIANSMIPKRASGNYLRMNIGENP
DLYGPFWITVTLIFSIAISGNIASYLQQATDAYKWHYNFHLVSYAATSIF
LYANILPAVLWALFKYSLKPVDSADAVETDSASYMPSLLSLMCIYGYSLA
IYIPVSILWVINISLLQWLLVITAALLSGTVLIAVLTPALRNSQFSLFLI
VGILSAHVVLAAGFLLYFFHNPTVPSLDPVAPTPAAPAAPAALKAVTQAV
VNAVPGNQTH*

LD38670.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:15:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG4645-PB 360 CG4645-PB 1..360 1..360 1845 100 Plus
CG4645-PC 360 CG4645-PC 1..360 1..360 1845 100 Plus
CG4645-PA 360 CG4645-PA 1..360 1..360 1845 100 Plus