Clone LD38910 Report

Search the DGRC for LD38910

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:389
Well:10
Vector:pOT2
Associated Gene/TranscriptCG8441-RA
Protein status:LD38910.pep: gold
Preliminary Size:988
Sequenced Size:844

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8441 2001-01-01 Release 2 assignment
CG8441 2001-10-10 Blastp of sequenced clone
CG8441 2003-01-01 Sim4 clustering to Release 3
CG8441 2008-04-29 Release 5.5 accounting
CG8441 2008-08-15 Release 5.9 accounting
CG8441 2008-12-18 5.12 accounting

Clone Sequence Records

LD38910.complete Sequence

844 bp (844 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061452

> LD38910.complete
TTTTAACCAAACAAACATGTCGCTTATAAAGAATTTGGTAAAAGAGCCCG
AACAGAAGGCAAAGAAAAAGAAAAAGAATGCGGGATCTGGAGAAAGCGAT
TCCGATGAGAAGGACAAGCCTCTGCGGCCGTTCATCAAAACCGCGACAGA
TCTACAGAGGCTGAAGCTGGAGAAGCTCATGAAGAATCCGGATAAGCCCG
TGGTCATACCGGAGCAGCGTCGCGAACGGGACTTCATGTCCTCGGTGCCC
ACGTTCGTGCGGAATGTGATGGGAAGCAGTGCTGGAGCGGGTTCCGGCGA
GTTCCATGTGTACCGCCACTTGCGACGCAAGGAGTACGCCCGCCAGAAGA
ACATCCAGAACCAGAGTGCCCGCGAAGCAGCAGATGAAGCTTACCAGCAG
AAGTTGGACGACAACAGACGCGCGGCCGAAGAAAAGACTGCTAAGAAACG
AGCCAAACGGTTGAAGAGAAAACAGAGGGCGAAAAAGCCGAGAGAGGACA
AGAAGCCACTGGCTAAGGAAGCCTCAGAGGATAGTAACACAGATTCCGAG
GAAGAGCCCACAGAAGAAAAGGCAGAAAGTAGCCCTGAGGAAGGACAACA
GGTGGCATCCAAGGAATCCGACGACAATAACACCCAAGAAACTTCGAATG
AAGAGGCAGTGAATTCAAATACAGAAGCGAAAAGCGCAGAGGACACAAAT
GCAGTGGAATTAGATAGCACCGAAGCTACAAAGGAATCCCAAAATGTGGA
TCAAGAACAAGACAAGCCTGTGCCTTAGTACCTCCTGTTCTATTCCTATC
AATAAACCGTTTAGAGTAATAAAAAAAAAAAAAAAAAAAAAAAA

LD38910.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:11:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG8441-RA 919 CG8441-RA 91..914 1..824 4120 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:57:49
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 12072444..12073074 820..190 3155 100 Minus
chr2R 21145070 chr2R 12073133..12073323 191..1 955 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:33:41 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:57:47
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16185118..16185752 824..190 3175 100 Minus
2R 25286936 2R 16185811..16186001 191..1 955 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:35:18
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 16186317..16186951 824..190 3175 100 Minus
2R 25260384 2R 16187010..16187200 191..1 955 100 Minus
Blast to na_te.dros performed 2019-03-16 11:57:47
Subject Length Description Subject Range Query Range Score Percent Strand
Doc2-element 4789 Doc2-element DOC2 4789bp 218..319 40..146 108 62.4 Plus

LD38910.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:58:53 Download gff for LD38910.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 12072444..12073073 191..820 100 <- Minus
chr2R 12073134..12073323 1..190 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:21:11 Download gff for LD38910.complete
Subject Subject Range Query Range Percent Splice Strand
CG8441-RA 1..762 17..778 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:50:32 Download gff for LD38910.complete
Subject Subject Range Query Range Percent Splice Strand
CG8441-RB 1..762 17..778 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:42:53 Download gff for LD38910.complete
Subject Subject Range Query Range Percent Splice Strand
CG8441-RA 1..762 17..778 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:19:36 Download gff for LD38910.complete
Subject Subject Range Query Range Percent Splice Strand
CG8441-RA 1..762 17..778 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:31:42 Download gff for LD38910.complete
Subject Subject Range Query Range Percent Splice Strand
CG8441-RA 1..762 17..778 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:35:13 Download gff for LD38910.complete
Subject Subject Range Query Range Percent Splice Strand
CG8441-RA 1..820 1..820 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:50:32 Download gff for LD38910.complete
Subject Subject Range Query Range Percent Splice Strand
CG8441-RB 119..938 1..820 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:42:53 Download gff for LD38910.complete
Subject Subject Range Query Range Percent Splice Strand
CG8441-RA 22..841 1..820 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:19:36 Download gff for LD38910.complete
Subject Subject Range Query Range Percent Splice Strand
CG8441-RA 1..820 1..820 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:31:42 Download gff for LD38910.complete
Subject Subject Range Query Range Percent Splice Strand
CG8441-RA 22..841 1..820 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:58:53 Download gff for LD38910.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16185122..16185751 191..820 100 <- Minus
2R 16185812..16186001 1..190 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:58:53 Download gff for LD38910.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16185122..16185751 191..820 100 <- Minus
2R 16185812..16186001 1..190 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:58:53 Download gff for LD38910.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16185122..16185751 191..820 100 <- Minus
2R 16185812..16186001 1..190 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:42:53 Download gff for LD38910.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12072627..12073256 191..820 100 <- Minus
arm_2R 12073317..12073506 1..190 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:56:18 Download gff for LD38910.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16186321..16186950 191..820 100 <- Minus
2R 16187011..16187200 1..190 100   Minus

LD38910.hyp Sequence

Translation from 0 to 777

> LD38910.hyp
FNQTNMSLIKNLVKEPEQKAKKKKKNAGSGESDSDEKDKPLRPFIKTATD
LQRLKLEKLMKNPDKPVVIPEQRRERDFMSSVPTFVRNVMGSSAGAGSGE
FHVYRHLRRKEYARQKNIQNQSAREAADEAYQQKLDDNRRAAEEKTAKKR
AKRLKRKQRAKKPREDKKPLAKEASEDSNTDSEEEPTEEKAESSPEEGQQ
VASKESDDNNTQETSNEEAVNSNTEAKSAEDTNAVELDSTEATKESQNVD
QEQDKPVP*

LD38910.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:57:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG8441-PB 253 CG8441-PB 1..253 6..258 1273 100 Plus
CG8441-PA 253 CG8441-PA 1..253 6..258 1273 100 Plus

LD38910.pep Sequence

Translation from 16 to 777

> LD38910.pep
MSLIKNLVKEPEQKAKKKKKNAGSGESDSDEKDKPLRPFIKTATDLQRLK
LEKLMKNPDKPVVIPEQRRERDFMSSVPTFVRNVMGSSAGAGSGEFHVYR
HLRRKEYARQKNIQNQSAREAADEAYQQKLDDNRRAAEEKTAKKRAKRLK
RKQRAKKPREDKKPLAKEASEDSNTDSEEEPTEEKAESSPEEGQQVASKE
SDDNNTQETSNEEAVNSNTEAKSAEDTNAVELDSTEATKESQNVDQEQDK
PVP*

LD38910.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:22:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13043-PA 226 GF13043-PA 1..224 1..216 727 72.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:22:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22295-PA 260 GG22295-PA 1..260 1..253 1059 84.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:22:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22998-PA 262 GH22998-PA 1..162 1..162 684 85.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:47:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG8441-PB 253 CG8441-PB 1..253 1..253 1273 100 Plus
CG8441-PA 253 CG8441-PA 1..253 1..253 1273 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:22:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18964-PA 245 GI18964-PA 1..223 1..229 676 67.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:22:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11391-PA 231 GL11391-PA 1..229 1..223 651 67.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:22:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21080-PA 236 GA21080-PA 1..167 1..167 650 83.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:22:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20084-PA 260 GM20084-PA 1..260 1..253 1021 91.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:22:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25562-PA 260 GD25562-PA 1..260 1..253 1072 91.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:22:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20907-PA 282 GJ20907-PA 1..196 1..185 711 79.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:22:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22164-PA 209 GK22164-PA 13..148 28..163 590 86 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:22:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14092-PA 257 GE14092-PA 1..257 1..253 892 84 Plus