Clone LD39230 Report

Search the DGRC for LD39230

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:392
Well:30
Vector:pOT2
Associated Gene/TranscriptCG6179-RA
Protein status:LD39230.pep: gold
Preliminary Size:1368
Sequenced Size:1252

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6179 2008-04-29 Release 5.5 accounting
CG6179 2008-04-29 Picked prior to 5.5
CG6179 2008-08-15 Release 5.9 accounting
CG6179 2008-12-18 5.12 accounting

Clone Sequence Records

LD39230.complete Sequence

1252 bp assembled on 2007-09-25

GenBank Submission: BT030994

> LD39230.complete
AAATAAACTATTTTAAGCAGTTTATTCAAATTTTTCGCTGCCAAATCCAG
GAAACTCTATTGAAATGACTCGCCACGCACGTAACTGCACGGCCGGAGCC
GTGTACACCTACAACGAGAAGAAGCGTGACGCGGCGGAGTCCGGCTACGG
CACGAATGCCCAGCGCCTGGGCAAGGATTCGGTGAAATCCTTCGACTGCT
GCTCCTTGACGCTGCAACCATGTCGCAGGCCAGTGATCACCAAGGATGGC
TATCTATTCGACAAGGAGGCCATCCTGCAGTACATCGTGACCAAGAAGAA
CGAGTACAGCCGCCGACTGAAGGAGTACGAGCGTCTGCGGCGCGCGGAGG
AGGATAAACTGAGCCAGGAGGCCAACAGCAAGCAGCAGGCGCGCATGGAG
CGCTTTGTTAATGCCGAGAAGCCAGCGATGACACCCGCCCACTCCTCGGC
CGCTGCCAGCGAGAAGCCGTCGACCTCTTCCGCCGCTGCTGCCGCTTCAT
CTGAATCCTCGTCCGCATCCTCGATATCCAACATGACCAACGGGCACGAG
AAGAAGCTGCCCAGCTTCTGGCTGCCCTCCGAGTGCCCCAATGCCGGGTT
AGCCAAGGCCCAGAAGCCCGACGCCACCATCTACTGCCCGGTGTCGCAGA
AACCGCTGCGAGTCAAGGATCTGATTGATGTGAAGTTCACGCTGCTCAAG
GACGGCGACACGAAGCGCTCGCTGATTGCCAAGGAGGCGCGCTACATGTG
CCCCATTACCCACGACGTGCTCAGCAACGCGGTGCCCTGCGCTGTGCTGC
GTCCCACTGGCGATGTGGTGACCATGGAGTGCGTGGAACGGCTGATCAGA
AAGGACATGATCCATCCGCTCACGGATCGCAAGCTCAAGGAGAAGGACAT
CATTCCCCTGCAGCGAGGCGGCACTGGCTACGCAACGACGAACGACCACC
TCCAGGCCAAGGAAAAACGGCCCATGCTCCAGGCCTAAGACGAATTTATA
TAGCCGCCAGCTACTTGGGAGCACTTCAATAGAAATGTAATCGTTTTAGC
ACTAGCTAGTTTAAACAATCAATTATTTCTCCAGATTTTAAAACAATTGT
GTATCATAACTTATACAAAACTTGGGTATTTTATCTGTTCCAATTCTACC
TTTTCGTTTATTGCAAGACGAAGTGCATACATACTTATTGTTAAATAGGA
AAAAACAAAATAAATACACTGATACTCGTACCACAAAAAAAAAAAAAAAA
AA

LD39230.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:35:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG6179-RA 1309 CG6179-RA 64..1298 1..1235 6175 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:34:47
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 18269314..18270120 1..807 3855 98.5 Plus
chrX 22417052 chrX 18270352..18270669 917..1234 1590 100 Plus
chrX 22417052 chrX 18270181..18270290 808..917 535 99.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:33:55 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:34:45
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 18380124..18380930 1..807 4035 100 Plus
X 23542271 X 18381162..18381480 917..1235 1595 100 Plus
X 23542271 X 18380991..18381100 808..917 550 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:31:50
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 18388222..18389028 1..807 4035 100 Plus
X 23527363 X 18389260..18389578 917..1235 1595 100 Plus
X 23527363 X 18389089..18389198 808..917 550 100 Plus
Blast to na_te.dros performed 2019-03-16 04:34:45
Subject Length Description Subject Range Query Range Score Percent Strand
Quasimodo 7387 Quasimodo QUASIMODO 7387bp Derived from P1 clones DS08479 & DS07153 by Sue Celniker, 29 March 2001. 6454..6599 1063..1204 135 57.8 Plus

LD39230.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:35:42 Download gff for LD39230.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 18270181..18270289 808..916 99 -> Plus
chrX 18269314..18270120 1..807 98 -> Plus
chrX 18270352..18270669 917..1234 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:21:26 Download gff for LD39230.complete
Subject Subject Range Query Range Percent Splice Strand
CG6179-RA 1..924 65..988 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:04:55 Download gff for LD39230.complete
Subject Subject Range Query Range Percent Splice Strand
CG6179-RA 1..924 65..988 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:34:48 Download gff for LD39230.complete
Subject Subject Range Query Range Percent Splice Strand
CG6179-RA 1..924 65..988 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:51:15 Download gff for LD39230.complete
Subject Subject Range Query Range Percent Splice Strand
CG6179-RA 1..924 65..988 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:44:24 Download gff for LD39230.complete
Subject Subject Range Query Range Percent Splice Strand
CG6179-RA 1..924 65..988 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 16:57:22 Download gff for LD39230.complete
Subject Subject Range Query Range Percent Splice Strand
CG6179-RA 42..1275 1..1234 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:04:55 Download gff for LD39230.complete
Subject Subject Range Query Range Percent Splice Strand
CG6179-RA 42..1275 1..1234 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:34:48 Download gff for LD39230.complete
Subject Subject Range Query Range Percent Splice Strand
CG6179-RA 43..1276 1..1234 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:51:15 Download gff for LD39230.complete
Subject Subject Range Query Range Percent Splice Strand
CG6179-RA 42..1275 1..1234 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:44:24 Download gff for LD39230.complete
Subject Subject Range Query Range Percent Splice Strand
CG6179-RA 43..1276 1..1234 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:35:42 Download gff for LD39230.complete
Subject Subject Range Query Range Percent Splice Strand
X 18380124..18380930 1..807 100 -> Plus
X 18380991..18381099 808..916 100 -> Plus
X 18381162..18381479 917..1234 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:35:42 Download gff for LD39230.complete
Subject Subject Range Query Range Percent Splice Strand
X 18380124..18380930 1..807 100 -> Plus
X 18380991..18381099 808..916 100 -> Plus
X 18381162..18381479 917..1234 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:35:42 Download gff for LD39230.complete
Subject Subject Range Query Range Percent Splice Strand
X 18380124..18380930 1..807 100 -> Plus
X 18380991..18381099 808..916 100 -> Plus
X 18381162..18381479 917..1234 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:34:48 Download gff for LD39230.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 18274157..18274963 1..807 100 -> Plus
arm_X 18275024..18275132 808..916 100 -> Plus
arm_X 18275195..18275512 917..1234 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:57:02 Download gff for LD39230.complete
Subject Subject Range Query Range Percent Splice Strand
X 18388222..18389028 1..807 100 -> Plus
X 18389089..18389197 808..916 100 -> Plus
X 18389260..18389577 917..1234 100   Plus

LD39230.pep Sequence

Translation from 64 to 987

> LD39230.pep
MTRHARNCTAGAVYTYNEKKRDAAESGYGTNAQRLGKDSVKSFDCCSLTL
QPCRRPVITKDGYLFDKEAILQYIVTKKNEYSRRLKEYERLRRAEEDKLS
QEANSKQQARMERFVNAEKPAMTPAHSSAAASEKPSTSSAAAAASSESSS
ASSISNMTNGHEKKLPSFWLPSECPNAGLAKAQKPDATIYCPVSQKPLRV
KDLIDVKFTLLKDGDTKRSLIAKEARYMCPITHDVLSNAVPCAVLRPTGD
VVTMECVERLIRKDMIHPLTDRKLKEKDIIPLQRGGTGYATTNDHLQAKE
KRPMLQA*

LD39230.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:52:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22434-PA 310 GF22434-PA 1..310 1..307 1399 85.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:52:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19162-PA 307 GG19162-PA 1..306 1..306 1606 97.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:52:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14677-PA 309 GH14677-PA 1..309 1..307 1382 84.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:18:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG6179-PA 307 CG6179-PA 1..307 1..307 1585 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:52:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13787-PA 309 GI13787-PA 1..309 1..307 1371 84.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:52:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26970-PA 307 GL26970-PA 1..307 1..307 1303 81.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:52:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19415-PA 307 GA19415-PA 1..307 1..307 1306 81.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:52:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22895-PA 307 GM22895-PA 1..307 1..307 1620 98.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:52:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17393-PA 675 GD17393-PA 1..281 1..281 1465 97.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:52:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13590-PA 311 GJ13590-PA 1..311 1..307 1340 83 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:52:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19865-PA 321 GK19865-PA 1..321 1..307 1344 79.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:52:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17724-PA 314 GE17724-PA 1..314 1..307 1487 92 Plus

LD39230.hyp Sequence

Translation from 64 to 987

> LD39230.hyp
MTRHARNCTAGAVYTYNEKKRDAAESGYGTNAQRLGKDSVKSFDCCSLTL
QPCRRPVITKDGYLFDKEAILQYIVTKKNEYSRRLKEYERLRRAEEDKLS
QEANSKQQARMERFVNAEKPAMTPAHSSAAASEKPSTSSAAAAASSESSS
ASSISNMTNGHEKKLPSFWLPSECPNAGLAKAQKPDATIYCPVSQKPLRV
KDLIDVKFTLLKDGDTKRSLIAKEARYMCPITHDVLSNAVPCAVLRPTGD
VVTMECVERLIRKDMIHPLTDRKLKEKDIIPLQRGGTGYATTNDHLQAKE
KRPMLQA*

LD39230.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:08:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG6179-PA 307 CG6179-PA 1..307 1..307 1585 100 Plus