Clone LD39271 Report

Search the DGRC for LD39271

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:392
Well:71
Vector:pOT2
Associated Gene/TranscriptCG17904-RA
Protein status:LD39271.pep: gold
Preliminary Size:1187
Sequenced Size:1060

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17904 2001-01-01 Release 2 assignment
CG17904 2003-01-01 Sim4 clustering to Release 3
CG17904 2003-02-22 Blastp of sequenced clone
CG17904 2008-04-29 Release 5.5 accounting
CG17904 2008-08-15 Release 5.9 accounting
CG17904 2008-12-18 5.12 accounting

Clone Sequence Records

LD39271.complete Sequence

1060 bp (1060 high quality bases) assembled on 2003-02-22

GenBank Submission: AY069623

> LD39271.complete
TTCATTTCACAATTAGTTTACGGAATTCGAACTATTGAAACTAAGAGCCA
TGCAGGCACCACCTCCGGAACACTGTCCTGGCGTCGAGAGCGAGGAGGCG
GGCAAGGGAAGTGCCTGTTCGGGCTGCCCCAACCAAGGACTCTGCAGCGA
TCCCAACAAGAAACTCGAAGATCCCGGCAAGGCTTTGGTGGTCGAATCCA
TGAAAGATGTCAAACACAAGCTGCTGATCCTGTCCGGGAAAGGCGGCGTT
GGCAAGAGCACGGTAACCAGCTTGCTAACCCGCTATCTGGCCAGAAGTAA
TCCGGACAGTAACTTCGGCGTGCTTGATATCGACATTTGCGGTCCATCGC
AACCGCGTTTGATGGGCGCCCTGGGGGAGAGTGTCCACCAGTCTGGGTAC
GGCTGGTCACCTGTGGGAATCGAAGACAACGTGTGTCTGATGTCCATCGG
ATTTCTTCTGGGCTCTGTGGACGATGCCATTATTTGGCGAGGACCCAAGA
AGAATGGCATGATCAGGCAGTTTCTGAGCGAGGTGGACTGGGGAAATCTG
GATCTCCTGCTACTGGACACACCACCTGGAACTTCCGATGAGCACCTGTC
TGTGGTTTCGTACCTGAAAGACGACGCCAACCCGGAGTCCCTGCGCGCCG
TGATGGTGACCACTCCACAGGAGGTGTCTCTGCTGGACGTGCGCAAGGAG
ATCAACTTTTGTAAAAAGCAAAATATCCCCATTGTGGGCGTGATCGAGAA
TATGAGCAGTTTCCGTTGCGGCCATTGTGGAAATAGCTCCGAAATCTTTC
CAGCCAAAACCGGAGGAGCCGCTGCCATGTGCGCCGAAATGGGAATCCCG
CTGTTGGGCTCCCTGCCTCTGGATCAACAGATATCCAAAGCCTGCGATTC
TGGCGAGGATTTAACTGAGTTTAAGAATGTCACCACTGAGGCGCTGGAAG
GAATTTGCTCAAAGATTATGGCCAGCTTTAGTTAAGAATAAGTTAAAGAC
CACTCAGTTTTTAAATAAAAAAAAAGATGCCTGTACAATTTTAAAAAAAA
AAAAAAAAAA

LD39271.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:19:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG17904-RA 1480 CG17904-RA 23..1065 1..1043 5215 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:08:53
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 16731325..16732366 1..1042 5150 99.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:33:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:08:51
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16732583..16733625 1..1043 5215 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:58:08
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16732583..16733625 1..1043 5215 100 Plus
Blast to na_te.dros performed 2019-03-15 16:08:52
Subject Length Description Subject Range Query Range Score Percent Strand
copia 5143 copia DMCOPIA 5143bp Derived from X02599 (g7740) (Rel. 49, Last updated, Version 4). 1123..1220 926..1028 116 60.2 Plus

LD39271.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:10:10 Download gff for LD39271.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 16731325..16732366 1..1042 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:21:30 Download gff for LD39271.complete
Subject Subject Range Query Range Percent Splice Strand
CG17904-RA 1..936 50..985 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:48:52 Download gff for LD39271.complete
Subject Subject Range Query Range Percent Splice Strand
CG17904-RA 1..936 50..985 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:53:37 Download gff for LD39271.complete
Subject Subject Range Query Range Percent Splice Strand
CG17904-RA 1..936 50..985 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:40:17 Download gff for LD39271.complete
Subject Subject Range Query Range Percent Splice Strand
CG17904-RA 1..936 50..985 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:27:43 Download gff for LD39271.complete
Subject Subject Range Query Range Percent Splice Strand
CG17904-RA 1..936 50..985 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:01:23 Download gff for LD39271.complete
Subject Subject Range Query Range Percent Splice Strand
CG17904-RA 23..1064 1..1042 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:48:52 Download gff for LD39271.complete
Subject Subject Range Query Range Percent Splice Strand
CG17904-RA 20..1061 1..1042 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:53:37 Download gff for LD39271.complete
Subject Subject Range Query Range Percent Splice Strand
CG17904-RA 34..1075 1..1042 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:40:17 Download gff for LD39271.complete
Subject Subject Range Query Range Percent Splice Strand
CG17904-RA 23..1064 1..1042 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:27:43 Download gff for LD39271.complete
Subject Subject Range Query Range Percent Splice Strand
CG17904-RA 34..1075 1..1042 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:10:10 Download gff for LD39271.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16732583..16733624 1..1042 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:10:10 Download gff for LD39271.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16732583..16733624 1..1042 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:10:10 Download gff for LD39271.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16732583..16733624 1..1042 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:53:37 Download gff for LD39271.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16732583..16733624 1..1042 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:10:38 Download gff for LD39271.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16732583..16733624 1..1042 100   Plus

LD39271.pep Sequence

Translation from 49 to 984

> LD39271.pep
MQAPPPEHCPGVESEEAGKGSACSGCPNQGLCSDPNKKLEDPGKALVVES
MKDVKHKLLILSGKGGVGKSTVTSLLTRYLARSNPDSNFGVLDIDICGPS
QPRLMGALGESVHQSGYGWSPVGIEDNVCLMSIGFLLGSVDDAIIWRGPK
KNGMIRQFLSEVDWGNLDLLLLDTPPGTSDEHLSVVSYLKDDANPESLRA
VMVTTPQEVSLLDVRKEINFCKKQNIPIVGVIENMSSFRCGHCGNSSEIF
PAKTGGAAAMCAEMGIPLLGSLPLDQQISKACDSGEDLTEFKNVTTEALE
GICSKIMASFS*

LD39271.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 06:27:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20875-PA 310 GF20875-PA 4..310 5..311 1436 90.2 Plus
Dana\GF10354-PA 261 GF10354-PA 2..254 51..306 546 46.2 Plus
Dana\GF22737-PA 310 GF22737-PA 9..213 49..263 291 35.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 06:27:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22765-PA 311 GG22765-PA 1..311 1..311 1584 96.1 Plus
Dere\GG16127-PA 260 GG16127-PA 2..254 51..306 566 47.3 Plus
Dere\GG21464-PA 294 GG21464-PA 16..283 38..311 309 33.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 06:27:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11560-PA 311 GH11560-PA 1..311 1..310 1375 83.9 Plus
Dgri\GH14587-PA 264 GH14587-PA 2..256 51..308 540 45.4 Plus
Dgri\GH13628-PA 292 GH13628-PA 32..254 49..285 290 34.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:38:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG17904-PA 311 CG17904-PA 1..311 1..311 1635 100 Plus
CG4858-PA 260 CG4858-PA 5..254 54..306 556 47.9 Plus
CG3262-PE 293 CG3262-PE 38..252 54..285 305 36.6 Plus
CG3262-PD 293 CG3262-PD 38..252 54..285 305 36.6 Plus
CG3262-PF 207 CG3262-PF 22..166 127..285 229 35.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 06:27:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17051-PA 310 GI17051-PA 1..310 1..310 1379 86.1 Plus
Dmoj\GI13405-PA 264 GI13405-PA 2..224 51..278 549 47.4 Plus
Dmoj\GI11769-PA 297 GI11769-PA 15..254 38..285 305 35.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 06:27:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18780-PA 311 GL18780-PA 1..311 1..311 1422 87.5 Plus
Dper\GL12799-PA 255 GL12799-PA 2..253 51..308 511 43.9 Plus
Dper\GL21144-PA 299 GL21144-PA 39..259 49..285 279 33.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 06:27:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14715-PA 311 GA14715-PA 1..311 1..311 1419 87.1 Plus
Dpse\GA18483-PA 258 GA18483-PA 2..256 51..308 541 45 Plus
Dpse\GA17025-PA 299 GA17025-PA 39..259 49..285 279 33.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 06:27:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17199-PA 311 GM17199-PA 1..311 1..311 1604 97.7 Plus
Dsec\GM22307-PA 260 GM22307-PA 2..224 51..278 558 49.6 Plus
Dsec\GM18803-PA 293 GM18803-PA 38..275 54..302 308 35.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 06:27:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24076-PA 311 GD24076-PA 1..311 1..311 1601 97.4 Plus
Dsim\GD14899-PA 260 GD14899-PA 2..224 51..278 558 49.6 Plus
Dsim\GD21613-PA 293 GD21613-PA 33..275 49..302 308 34.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 06:27:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17301-PA 310 GJ17301-PA 1..310 1..310 1389 85.2 Plus
Dvir\GJ11530-PA 266 GJ11530-PA 2..224 51..278 542 47.4 Plus
Dvir\GJ13135-PA 298 GJ13135-PA 32..254 49..285 282 32.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 06:27:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24826-PA 310 GK24826-PA 4..310 5..311 1376 85.7 Plus
Dwil\GK12055-PA 261 GK12055-PA 2..254 51..306 545 45.8 Plus
Dwil\GK23989-PA 303 GK23989-PA 40..260 49..285 297 35.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 06:27:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12759-PA 311 GE12759-PA 1..311 1..311 1605 97.7 Plus
Dyak\GE23241-PA 260 GE23241-PA 2..258 51..310 568 47.3 Plus
Dyak\GE19695-PA 260 GE19695-PA 2..258 51..310 567 47 Plus
Dyak\GE12953-PA 293 GE12953-PA 33..252 49..285 309 37.1 Plus

LD39271.hyp Sequence

Translation from 49 to 984

> LD39271.hyp
MQAPPPEHCPGVESEEAGKGSACSGCPNQGLCSDPNKKLEDPGKALVVES
MKDVKHKLLILSGKGGVGKSTVTSLLTRYLARSNPDSNFGVLDIDICGPS
QPRLMGALGESVHQSGYGWSPVGIEDNVCLMSIGFLLGSVDDAIIWRGPK
KNGMIRQFLSEVDWGNLDLLLLDTPPGTSDEHLSVVSYLKDDANPESLRA
VMVTTPQEVSLLDVRKEINFCKKQNIPIVGVIENMSSFRCGHCGNSSEIF
PAKTGGAAAMCAEMGIPLLGSLPLDQQISKACDSGEDLTEFKNVTTEALE
GICSKIMASFS*

LD39271.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:05:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG17904-PA 311 CG17904-PA 1..311 1..311 1635 100 Plus
CG4858-PA 260 CG4858-PA 5..254 54..306 556 47.9 Plus
CG3262-PE 293 CG3262-PE 38..252 54..285 305 36.6 Plus
CG3262-PD 293 CG3262-PD 38..252 54..285 305 36.6 Plus
CG3262-PF 207 CG3262-PF 22..166 127..285 229 35.8 Plus