Clone LD39331 Report

Search the DGRC for LD39331

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:393
Well:31
Vector:pOT2
Associated Gene/Transcriptl(3)01239-RA
Protein status:LD39331.pep: gold
Sequenced Size:797

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
l(3)01239 2009-06-08 Manual selection by Joe Carlson

Clone Sequence Records

LD39331.complete Sequence

797 bp assembled on 2009-07-30

GenBank Submission: BT089005.1

> LD39331.complete
TTCGGTCTCGTATTTTGAAAGAAAATCGCAGATTATCGCCAATTTGAAGC
GATTATCCCGGTCTAGATTTCGAAGGGGTCCTTTTGGATAGCGAACATTG
CAATGAGCACCGAATCGGCGAAGCCGGCACTCAGCCAGGAGGCCATTGTG
GCCCAGTTCCAACAGCTGCGCAATGAGCAGCGCAATTTGGTCAACAGTTT
AAATACGCTCGAAATGGATTTGAGGGAACACAAAACTGTGATAGAAACTC
TGGAGGCGGCGGATCCCGAACGGAAATGCTTTCGTCAAATTGGTGGTGTG
CTGTGCGAAAGGACCGTGAAGGAGGTGCTGCCACAGCTGGTGGAGAACAA
GGATTTCATCGCCAAGACCATCCAAATGGTCACCAATGACCTGAGCAAAA
AGGGCAGTGAGCTGAACAAGTTCAAGGAGGAGCACAATATCAAGATTCGC
GGCGAACACTTGGTTGCCGAAGGAGCCAAGGGCGACGATGCGGAGGACAA
GGCGGAGAACCGTAATGTCCTGGTGTTCAACTGAGAGCGATTGATTACCT
CACCACACCGTATTTATTGTGTCTATGTTGAGAGGGAACTCTGCCAGGAT
TTGCGAGCGATAATCCGCGTTTATTGAACACTTCTAATGTTGTATGTACT
TCTAGCTGTAAGGCGCAGTTCGCGAAACGCCTCCAATCGCACCTTCACAC
CAACACTATCCATCAATTCCCCTCATTTAAACTTAACCCACTCTGGCCAC
GAATTAAAGATACCTTAAACTTCCGATTGAAAAAAAAAAAAAAAAAA

LD39331.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:27:08
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)01239-RA 1062 l(3)01239-RA 110..891 1..782 3910 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:05:42
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 11064360..11064905 779..234 2700 99.6 Minus
chr3L 24539361 chr3L 11065010..11065242 233..1 1165 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:34:03 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:05:40
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11073463..11074011 782..234 2745 100 Minus
3L 28110227 3L 11074116..11074348 233..1 1165 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:21:37
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 11066563..11067111 782..234 2745 100 Minus
3L 28103327 3L 11067216..11067448 233..1 1165 100 Minus
Blast to na_te.dros performed on 2019-03-15 17:05:40 has no hits.

LD39331.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:06:34 Download gff for LD39331.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 11064360..11064905 234..779 99 <- Minus
chr3L 11065010..11065242 1..233 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:12:17 Download gff for LD39331.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)01239-RA 1..432 103..534 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:53:08 Download gff for LD39331.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)01239-RA 1..432 103..534 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:26:50 Download gff for LD39331.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)01239-RA 1..432 103..534 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:25:25 Download gff for LD39331.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)01239-RA 1..432 103..534 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-07-30 13:55:24 Download gff for LD39331.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)01239-RA 43..821 1..779 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:53:08 Download gff for LD39331.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)01239-RA 43..821 1..779 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:26:50 Download gff for LD39331.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)01239-RA 41..819 1..779 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:25:25 Download gff for LD39331.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)01239-RA 41..819 1..779 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:06:34 Download gff for LD39331.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11073466..11074011 234..779 100 <- Minus
3L 11074116..11074348 1..233 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:06:34 Download gff for LD39331.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11073466..11074011 234..779 100 <- Minus
3L 11074116..11074348 1..233 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:06:34 Download gff for LD39331.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11073466..11074011 234..779 100 <- Minus
3L 11074116..11074348 1..233 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:26:50 Download gff for LD39331.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11066566..11067111 234..779 100 <- Minus
arm_3L 11067216..11067448 1..233 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:44:01 Download gff for LD39331.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11066566..11067111 234..779 100 <- Minus
3L 11067216..11067448 1..233 100   Minus

LD39331.hyp Sequence

Translation from 102 to 533

> LD39331.hyp
MSTESAKPALSQEAIVAQFQQLRNEQRNLVNSLNTLEMDLREHKTVIETL
EAADPERKCFRQIGGVLCERTVKEVLPQLVENKDFIAKTIQMVTNDLSKK
GSELNKFKEEHNIKIRGEHLVAEGAKGDDAEDKAENRNVLVFN*

LD39331.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:29:06
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)01239-PB 143 CG6302-PB 1..143 1..143 718 100 Plus
l(3)01239-PA 143 CG6302-PA 1..143 1..143 718 100 Plus

LD39331.pep Sequence

Translation from 102 to 533

> LD39331.pep
MSTESAKPALSQEAIVAQFQQLRNEQRNLVNSLNTLEMDLREHKTVIETL
EAADPERKCFRQIGGVLCERTVKEVLPQLVENKDFIAKTIQMVTNDLSKK
GSELNKFKEEHNIKIRGEHLVAEGAKGDDAEDKAENRNVLVFN*

LD39331.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:21:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23951-PA 143 GF23951-PA 1..143 1..143 677 90.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:21:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13945-PA 143 GG13945-PA 1..143 1..143 693 94.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:21:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16570-PA 145 GH16570-PA 1..145 1..143 579 79.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:20
Subject Length Description Subject Range Query Range Score Percent Strand
Pfdn2-PB 143 CG6302-PB 1..143 1..143 718 100 Plus
Pfdn2-PA 143 CG6302-PA 1..143 1..143 718 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:21:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13861-PA 144 GI13861-PA 1..143 1..141 558 76.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:21:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17097-PA 145 GL17097-PA 1..145 1..143 607 81.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:21:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19501-PA 145 GA19501-PA 1..145 1..143 607 81.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:22:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24780-PA 143 GM24780-PA 1..143 1..143 734 98.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:22:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12831-PA 143 GD12831-PA 1..143 1..143 732 97.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:22:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11721-PA 145 GJ11721-PA 1..145 1..143 589 80 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:22:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11428-PA 148 GK11428-PA 1..148 1..143 605 80.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:22:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20243-PA 143 GE20243-PA 1..143 1..143 690 93.7 Plus